KEGG   Mycobacterium tuberculosis H37Ra: MRA_3063Help
Entry
MRA_3063          CDS       T00540                                 

Definition
glycosyl transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MRA_3063
Enzymes [BR:mra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MRA_3063
Glycosyltransferases [BR:mra01003]
 Polysaccharide
  Storage polysaccharide
   MRA_3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3403704..3404948
Genome map
AA seq 414 aa AA seqDB search
MRILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEG
VRVIAAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKLGTDRSWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMND
EITELFGPGLAEITVIRNGIDAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPR
LRRTHPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPS
HYEPFGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPA
AAQRRARAARQRLTSDFDWQTVATATAQVYLAAKRGERQPQPRLPIVEHALPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcctcatggtgtcgtgggagtacccgccggtggtgatcggcggactcggccgc
cacgtgcatcatctgtcgaccgcgctagccgcagccggtcacgatgtcgtcgtgttgtcc
cggtgtccgtcgggcaccgatcccagcacacacccatcctccgatgaggtgaccgaaggg
gtccgggtgattgcggccgcgcaggacccgcacgagttcacgtttggcaacgacatgatg
gcctggaccctggcgatgggccacgccatgatccgcgccgggctgcgcttgaagaaactt
ggcaccgaccgctcgtggcgtcctgacgtcgtgcacgcacacgactggctggtggcccat
ccggccatcgcccttgcccagttctatgacgtgccaatggtttccacgattcatgcaacg
gaggccggtcgacattccggctgggtctccggagctctcagccgtcaggtgcacgcggtc
gagtcgtggctggtgcgtgaatccgattcgctgatcacatgctcggcgtcgatgaacgac
gagatcaccgagctgttcgggcccgggctggccgagatcaccgtgatccgtaacggcatt
gacgcggcgcgctggccgttcgcggcccgccgcccgcgcaccgggccagccgaattgctc
tatgtggggcggctggagtacgagaagggcgtgcacgacgccatcgccgcgctgccgcgg
ctcaggcgcactcacccaggcaccacactgaccatcgccggcgaaggcacccagcaggat
tggttgatcgatcaggcccgcaaacaccgggtgctcagagcaaccaggttcgtcggacac
ctcgaccacaccgagctgctggcgttgctgcaccgagccgacgccgcggtgctgcccagc
cactacgaaccgtttgggctggtggcactggaggccgccgcggccggcaccccgctggtg
acgtccaacatcggcggtctgggtgaagcggtcatcaatggacagaccggggtgtcgtgt
gcaccccgcgacgtagcggggctggccgccgcggtgcgtagcgtgctcgacgatccggcc
gccgcgcagcggcgcgcacgagccgcccggcaacggctcacctccgacttcgactggcag
acggtggccaccgcgaccgcgcaggtgtacctggcggcgaagcgcggtgaacggcagccg
cagccccggttgcccatcgtcgagcacgctcttcccgatcggtag

DBGET integrated database retrieval system