KEGG   Mycobacterium tuberculosis H37Ra: MRA_3359Help
Entry
MRA_3359          CDS       T00540                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00020  Citrate cycle (TCA cycle)
mra00190  Oxidative phosphorylation
mra00650  Butanoate metabolism
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra01130  Biosynthesis of antibiotics
mra01200  Carbon metabolism
Module
mra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mra_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MRA_3359 (sdhD)
   00650 Butanoate metabolism
    MRA_3359 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MRA_3359 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABQ75142
UniProt: A5U7Z2
Position
3715278..3715712
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHVFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacgtgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system