KEGG   Mycobacterium tuberculosis H37Ra: MRA_3359Help
Entry
MRA_3359          CDS       T00540                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRA_3359 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MRA_3359 (sdhD)
   00650 Butanoate metabolism
    MRA_3359 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MRA_3359 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3715278..3715712
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHVFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacgtgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system