KEGG   Mycobacterium tuberculosis H37Ra: MRA_3585Help
Entry
MRA_3585          CDS       T00540                                 

Gene name
fadA5
Definition
(GenBank) acetyl-CoA acetyltransferase FadA5
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MRA_3585 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    MRA_3585 (fadA5)
   00640 Propanoate metabolism
    MRA_3585 (fadA5)
   00650 Butanoate metabolism
    MRA_3585 (fadA5)
  Lipid metabolism
   00071 Fatty acid degradation
    MRA_3585 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    MRA_3585 (fadA5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRA_3585 (fadA5)
   00310 Lysine degradation
    MRA_3585 (fadA5)
   00380 Tryptophan metabolism
    MRA_3585 (fadA5)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MRA_3585 (fadA5)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRA_3585 (fadA5)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MRA_3585 (fadA5)
Enzymes [BR:mra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MRA_3585 (fadA5)
Exosome [BR:mra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MRA_3585 (fadA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3994223..3995398
Genome map
AA seq 391 aa AA seqDB search
MGYPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQSGLHAGDVEQVIGGCV
TQFGEQSNNISRVAWLTAGLPEHVGATTVDCQCGSGQQANHLIAGLIAAGAIDVGIACGI
EAMSRVGLGANAGPDRSLIRAQSWDIDLPNQFEAAERIAKRRGITREDVDVFGLESQRRA
QRAWAEGRFDREISPIQAPVLDEQNQPTGERRLVFRDQGLRETTMAGLGELKPVLEGGIH
TAGTSSQISDGAAAVLWMDEAVARAHGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLE
KAGMKIGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTA
LHELERTDQSLALITMCAGGALSTGTIIERI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggttacccggtcatcgttgaagccacccgcagccccatcggcaaacgcaacggatgg
ctgtcggggctgcatgccaccgagttgttgggcgcggtgcaaaaggcggtggtcgacaag
gccggcatccagtccggccttcacgccggtgacgtcgaacaggtcatcggcggttgcgtg
acccagttcggggagcaatccaacaacatcagccgggtggcctggctgacggccggtttg
cccgaacacgtcggcgccaccaccgtcgactgccagtgcggcagcggccagcaggccaac
catctgattgccgggttgatcgcggccggtgccatcgatgtcggcatcgcctgcggcatc
gaggcgatgagccgggtcgggctgggcgccaacgccgggccggaccgctcgctgatccgc
gcgcagtcatgggatatcgacctgccgaaccagttcgaggccgccgagcggatcgccaag
cggcgcggcatcacccgcgaggacgtggatgtcttcgggctcgagtcgcagcgacgcgcg
cagcgggcctgggcggagggccgctttgaccgcgagatctcgccgatccaggcgccggtg
ctcgacgagcagaatcagcccaccggcgagcggcgcctggtctttcgcgaccagggcctg
cgcgagaccacgatggcggggctaggcgagctgaaaccggtgctcgagggcggcatccac
accgcgggcacgtcgtcgcagatctccgacggcgcggcagccgtgttgtggatggacgaa
gccgtggcacgtgcgcacggcctgaccccgcgggcccggatcgtcgcccaggcactcgtc
ggcgccgagccctactaccacctggacggcccggtgcagtccaccgcgaaggtgctggag
aaggccggcatgaagatcggcgacatcgacatcgtcgagatcaacgaggcgttcgcgtcc
gtggtgctgtcctgggcgcgggtgcacgagcccgacatggaccgggtcaacgtcaacggc
ggggcgatcgcgctggggcatccggtgggctgcaccggcagccggctgatcaccaccgcc
ctgcacgagctcgagcgcaccgaccagagcctcgcgctgatcaccatgtgcgccggcggg
gccctgtccaccggcaccatcatcgagcggatttaa

DBGET integrated database retrieval system