KEGG   Mycobacterium tuberculosis H37Ra: MRA_3719Help
Entry
MRA_3719          CDS       T00540                                 

Definition
(GenBank) cysteine synthase/cystathionine beta-synthase family protein
  KO
K01738  cysteine synthase A [EC:2.5.1.47]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00270  Cysteine and methionine metabolism
mra00920  Sulfur metabolism
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra01130  Biosynthesis of antibiotics
mra01200  Carbon metabolism
mra01230  Biosynthesis of amino acids
Module
mra_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MRA_3719
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MRA_3719
Enzymes [BR:mra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     MRA_3719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABQ75508
UniProt: A5U908
Position
4133885..4134925
Genome map
AA seq 346 aa AA seqDB search
MIEADARRSADTHLLRYPLPAAWCTDVDVELYLKDETTHITGSLKHRLARSLFLYALCNG
WINENTTVVEASSGSTAVSEAYFAALLGLPFIAVMPAATSASKIALIESQGGRCHFVQNS
SQVYAEAERVAKETGGHYLDQFTNAERATDWRGNNNIAESIYVQMREEKHPTPEWIVVGA
GTGGTSATIGRYIRYRRHATRLCVVDPENSAFFPAYSEGRYDIVMPTSSRIEGIGRPRVE
PSFLPGVVDRMVAVPDAASIAAARHVSAVLGRRVGPSTGTNLWGAFGLLAEMVKQGRSGS
VVTLLADSGDRYADTYFSDEWVSAQGLDPAGPAAALVEFERSCRWT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaggcggacgcccgccgtagcgccgacacccacctgctgcgctacccactgccc
gctgcctggtgcacggatgtcgacgtcgagctgtacctcaaggacgagacgacccatatc
accggcagtctcaaacaccggttggcacgttcgttgttcctctatgcgctatgcaacggc
tggatcaacgagaacaccacggtggtggaggcatcgtcgggttcaacggcggtgtccgag
gcctatttcgcggcgctgctgggtctgccgttcatcgccgtgatgccggccgcgaccagc
gcttccaaaatcgcgttgatcgaatcacaaggtggccgttgtcatttcgtccagaattca
agtcaagtgtacgccgaggcggagcgcgtcgccaaggaaaccggcggccactatctggac
cagttcaccaacgcggagcgcgcaaccgactggcgcggcaacaacaacatcgccgagtcg
atctacgtgcaaatgcgcgaagagaagcaccccaccccggaatggatcgtcgtgggtgcg
ggcaccggcggaaccagcgcgacgatcggccgctacatccgctaccgacggcacgcgacc
cggctgtgcgtcgtcgatccggagaattccgcgttcttccccgcgtactccgaaggccgg
tacgacatcgtcatgcccacatcgtcccgtatcgagggcatcggccggccgcgggtcgag
ccgtcgtttctgcccggtgtggtcgaccgcatggtggcggtccccgacgcggcgtcgatc
gctgccgcccggcatgtcagcgccgttctggggcgccgagtgggaccgtctaccggcacc
aacctctggggcgcgttcggactgctcgccgagatggtcaagcagggccgcagcggctcg
gtggtcacactgctcgccgacagcggcgatcgctacgccgacacctacttttccgacgag
tgggtcagtgcccaggggctcgatccggccgggccggctgcggcgctggtggaattcgag
cgctcctgtcgatggacgtga

DBGET integrated database retrieval system