KEGG   Mycobacterium tuberculosis H37Ra: MRA_3719Help
Entry
MRA_3719          CDS       T00540                                 

Definition
(RefSeq) cysteine synthase/cystathionine beta-synthase
  KO
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRA_3719
   01230 Biosynthesis of amino acids
    MRA_3719
  Energy metabolism
   00920 Sulfur metabolism
    MRA_3719
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MRA_3719
Enzymes [BR:mra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     MRA_3719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4133885..4134925
Genome map
AA seq 346 aa AA seqDB search
MIEADARRSADTHLLRYPLPAAWCTDVDVELYLKDETTHITGSLKHRLARSLFLYALCNG
WINENTTVVEASSGSTAVSEAYFAALLGLPFIAVMPAATSASKIALIESQGGRCHFVQNS
SQVYAEAERVAKETGGHYLDQFTNAERATDWRGNNNIAESIYVQMREEKHPTPEWIVVGA
GTGGTSATIGRYIRYRRHATRLCVVDPENSAFFPAYSEGRYDIVMPTSSRIEGIGRPRVE
PSFLPGVVDRMVAVPDAASIAAARHVSAVLGRRVGPSTGTNLWGAFGLLAEMVKQGRSGS
VVTLLADSGDRYADTYFSDEWVSAQGLDPAGPAAALVEFERSCRWT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaggcggacgcccgccgtagcgccgacacccacctgctgcgctacccactgccc
gctgcctggtgcacggatgtcgacgtcgagctgtacctcaaggacgagacgacccatatc
accggcagtctcaaacaccggttggcacgttcgttgttcctctatgcgctatgcaacggc
tggatcaacgagaacaccacggtggtggaggcatcgtcgggttcaacggcggtgtccgag
gcctatttcgcggcgctgctgggtctgccgttcatcgccgtgatgccggccgcgaccagc
gcttccaaaatcgcgttgatcgaatcacaaggtggccgttgtcatttcgtccagaattca
agtcaagtgtacgccgaggcggagcgcgtcgccaaggaaaccggcggccactatctggac
cagttcaccaacgcggagcgcgcaaccgactggcgcggcaacaacaacatcgccgagtcg
atctacgtgcaaatgcgcgaagagaagcaccccaccccggaatggatcgtcgtgggtgcg
ggcaccggcggaaccagcgcgacgatcggccgctacatccgctaccgacggcacgcgacc
cggctgtgcgtcgtcgatccggagaattccgcgttcttccccgcgtactccgaaggccgg
tacgacatcgtcatgcccacatcgtcccgtatcgagggcatcggccggccgcgggtcgag
ccgtcgtttctgcccggtgtggtcgaccgcatggtggcggtccccgacgcggcgtcgatc
gctgccgcccggcatgtcagcgccgttctggggcgccgagtgggaccgtctaccggcacc
aacctctggggcgcgttcggactgctcgccgagatggtcaagcagggccgcagcggctcg
gtggtcacactgctcgccgacagcggcgatcgctacgccgacacctacttttccgacgag
tgggtcagtgcccaggggctcgatccggccgggccggctgcggcgctggtggaattcgag
cgctcctgtcgatggacgtga

DBGET integrated database retrieval system