KEGG   Mycobacterium tuberculosis H37Ra: MRA_3719Help
Entry
MRA_3719          CDS       T00540                                 

Definition
cysteine synthase/cystathionine beta-synthase
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRA_3719
   01230 Biosynthesis of amino acids
    MRA_3719
  Energy metabolism
   00920 Sulfur metabolism
    MRA_3719
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MRA_3719
Enzymes [BR:mra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     MRA_3719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4133885..4134925
Genome map
AA seq 346 aa AA seqDB search
MIEADARRSADTHLLRYPLPAAWCTDVDVELYLKDETTHITGSLKHRLARSLFLYALCNG
WINENTTVVEASSGSTAVSEAYFAALLGLPFIAVMPAATSASKIALIESQGGRCHFVQNS
SQVYAEAERVAKETGGHYLDQFTNAERATDWRGNNNIAESIYVQMREEKHPTPEWIVVGA
GTGGTSATIGRYIRYRRHATRLCVVDPENSAFFPAYSEGRYDIVMPTSSRIEGIGRPRVE
PSFLPGVVDRMVAVPDAASIAAARHVSAVLGRRVGPSTGTNLWGAFGLLAEMVKQGRSGS
VVTLLADSGDRYADTYFSDEWVSAQGLDPAGPAAALVEFERSCRWT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaggcggacgcccgccgtagcgccgacacccacctgctgcgctacccactgccc
gctgcctggtgcacggatgtcgacgtcgagctgtacctcaaggacgagacgacccatatc
accggcagtctcaaacaccggttggcacgttcgttgttcctctatgcgctatgcaacggc
tggatcaacgagaacaccacggtggtggaggcatcgtcgggttcaacggcggtgtccgag
gcctatttcgcggcgctgctgggtctgccgttcatcgccgtgatgccggccgcgaccagc
gcttccaaaatcgcgttgatcgaatcacaaggtggccgttgtcatttcgtccagaattca
agtcaagtgtacgccgaggcggagcgcgtcgccaaggaaaccggcggccactatctggac
cagttcaccaacgcggagcgcgcaaccgactggcgcggcaacaacaacatcgccgagtcg
atctacgtgcaaatgcgcgaagagaagcaccccaccccggaatggatcgtcgtgggtgcg
ggcaccggcggaaccagcgcgacgatcggccgctacatccgctaccgacggcacgcgacc
cggctgtgcgtcgtcgatccggagaattccgcgttcttccccgcgtactccgaaggccgg
tacgacatcgtcatgcccacatcgtcccgtatcgagggcatcggccggccgcgggtcgag
ccgtcgtttctgcccggtgtggtcgaccgcatggtggcggtccccgacgcggcgtcgatc
gctgccgcccggcatgtcagcgccgttctggggcgccgagtgggaccgtctaccggcacc
aacctctggggcgcgttcggactgctcgccgagatggtcaagcagggccgcagcggctcg
gtggtcacactgctcgccgacagcggcgatcgctacgccgacacctacttttccgacgag
tgggtcagtgcccaggggctcgatccggccgggccggctgcggcgctggtggaattcgag
cgctcctgtcgatggacgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system