KEGG   Mycobacterium tuberculosis H37Ra: MRA_3719Help
Entry
MRA_3719          CDS       T00540                                 

Definition
cysteine synthase/cystathionine beta-synthase
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Class
Metabolism; Overview; Carbon metabolism [PATH:mra01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mra01230]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mra00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:mra00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4133885..4134925
Genome map
AA seq 346 aa AA seqDB search
MIEADARRSADTHLLRYPLPAAWCTDVDVELYLKDETTHITGSLKHRLARSLFLYALCNG
WINENTTVVEASSGSTAVSEAYFAALLGLPFIAVMPAATSASKIALIESQGGRCHFVQNS
SQVYAEAERVAKETGGHYLDQFTNAERATDWRGNNNIAESIYVQMREEKHPTPEWIVVGA
GTGGTSATIGRYIRYRRHATRLCVVDPENSAFFPAYSEGRYDIVMPTSSRIEGIGRPRVE
PSFLPGVVDRMVAVPDAASIAAARHVSAVLGRRVGPSTGTNLWGAFGLLAEMVKQGRSGS
VVTLLADSGDRYADTYFSDEWVSAQGLDPAGPAAALVEFERSCRWT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaggcggacgcccgccgtagcgccgacacccacctgctgcgctacccactgccc
gctgcctggtgcacggatgtcgacgtcgagctgtacctcaaggacgagacgacccatatc
accggcagtctcaaacaccggttggcacgttcgttgttcctctatgcgctatgcaacggc
tggatcaacgagaacaccacggtggtggaggcatcgtcgggttcaacggcggtgtccgag
gcctatttcgcggcgctgctgggtctgccgttcatcgccgtgatgccggccgcgaccagc
gcttccaaaatcgcgttgatcgaatcacaaggtggccgttgtcatttcgtccagaattca
agtcaagtgtacgccgaggcggagcgcgtcgccaaggaaaccggcggccactatctggac
cagttcaccaacgcggagcgcgcaaccgactggcgcggcaacaacaacatcgccgagtcg
atctacgtgcaaatgcgcgaagagaagcaccccaccccggaatggatcgtcgtgggtgcg
ggcaccggcggaaccagcgcgacgatcggccgctacatccgctaccgacggcacgcgacc
cggctgtgcgtcgtcgatccggagaattccgcgttcttccccgcgtactccgaaggccgg
tacgacatcgtcatgcccacatcgtcccgtatcgagggcatcggccggccgcgggtcgag
ccgtcgtttctgcccggtgtggtcgaccgcatggtggcggtccccgacgcggcgtcgatc
gctgccgcccggcatgtcagcgccgttctggggcgccgagtgggaccgtctaccggcacc
aacctctggggcgcgttcggactgctcgccgagatggtcaagcagggccgcagcggctcg
gtggtcacactgctcgccgacagcggcgatcgctacgccgacacctacttttccgacgag
tgggtcagtgcccaggggctcgatccggccgggccggctgcggcgctggtggaattcgag
cgctcctgtcgatggacgtga

DBGET integrated database retrieval system