KEGG   Meiothermus ruber DSM 1279: Mrub_0287Help
Entry
Mrub_0287         CDS       T01193                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mrb  Meiothermus ruber DSM 1279
Brite
Enzymes [BR:mrb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Mrub_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252387..253388
Genome map
AA seq 333 aa AA seqDB search
MYLTRWTFVGVCLGLMVWAQPGPPLRSLAEARKIQIGAAVEPSLLLQEPQYAQVLAREFN
LVVAENVMKWGALQTARGEYNFAAADLLLNFAQRNRQAVRGHTLVWHQQLPRWMYGSFTS
AEMEAILSDHIRTVVGRYRGQIAYWDVVNEAIGDDARLRSTPFDVLPGYLEKAFRLARAA
DPSAKLFYNDYGAEGLGAKSDAIYALLKELRARGVPVDGVGFQVHVDSSFSPRQVRMAEN
LERFAQLGLEIHITEMDVLLSSTGSRAERLERQAQVYREVLQVCLRQPRCKVFTLWGFTD
AHSWRGASEPLIFDVDYQPKPAYFALQRTLQQP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtacctaactcgctggactttcgtgggggtttgcttgggactgatggtatgggcccag
cccggcccgccgctgcgaagcctggccgaggctcggaaaattcagatcggagcggctgtg
gaaccgagtctgctgctgcaggaaccccagtacgcccaggtgctggctcgggagttcaac
ctggtggtggccgagaacgtgatgaagtggggggccttgcagaccgctcgaggtgagtac
aactttgccgctgccgacctgcttctgaactttgcccagaggaaccggcaggcggtgcgg
gggcataccctggtctggcaccagcaactgccccgctggatgtacggcagttttacctcg
gccgagatggaggccatcctgagcgatcacatccgcaccgtggtggggcgttaccgcggc
caaatcgcctactgggacgtggtgaacgaggcgatcggcgacgatgcccggctgcgctcg
acgcccttcgatgtgctgcccggctacctggaaaaagcctttcggctggcccgtgcggcc
gaccccagcgccaagctgttctacaacgactacggggccgagggcctgggggccaagtcg
gatgccatctacgcgcttctgaaggagctcagagcaaggggggtgccggtggatggggtg
ggcttccaggtgcacgtggactcgagcttctcccccaggcaggtgcggatggccgagaac
ctcgagcgcttcgcccagctcggactggaaattcacatcaccgagatggacgtgctgcta
agtagcaccggctccagagccgaacggctcgagaggcaggcccaggtgtaccgcgaagtg
ctgcaagtctgcttgcgccagccccgctgcaaggtcttcaccctgtggggctttaccgat
gcccactcctggcggggggccagcgagcccctcatcttcgacgtggattaccaacccaaa
ccggcctactttgccctccagcgcaccttacaacaaccctaa

DBGET integrated database retrieval system