KEGG   Meiothermus ruber DSM 1279: Mrub_0334Help
Entry
Mrub_0334         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(304992..305324)
Genome map
AA seq 110 aa AA seqDB search
MSWLVVFLALFVLIALFGLVNYWGYRRVEQAQQAWFRQMLGEGVDLEAFLQSAPYEYRPL
KGSKAYGIVDKRTGEEVYRVKTPEEAEAWIVTNTLAEQGKLPQAGSEKSG
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcttgtggtttttctggccctctttgtgctcatcgccctgtttggcctggtc
aactactggggctaccggcgggtcgagcaggcccagcaggcctggtttcgccagatgctg
ggggagggggtggatctcgaggccttcctccagtcggccccttacgagtacaggcccctc
aagggcagcaaggcctacggcatcgtggacaagcgcaccggtgaggaagtctaccgggtc
aaaacccccgaggaggccgaggcctggatcgtgaccaacaccctggccgagcagggaaag
ctgccacaggccgggtcggaaaagtcgggctga

DBGET integrated database retrieval system