KEGG   Meiothermus ruber DSM 1279: Mrub_0338Help
Entry
Mrub_0338         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD27116
UniProt: D3PM05
Position
309148..309357
Genome map
AA seq 69 aa AA seqDB search
MVTGDRGYRSWALKAQVAWRKECFLRGHRLVGVVLLGYGLLRLMERDPTWRLLVGQFREI
WLFRIGVYF
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
gtggtcacgggggacaggggctatcggagctgggcgctcaaggcacaggtggcctggcgg
aaggagtgctttttgcgagggcatcggctggtcggagtggtgcttctgggctatggcctc
ctcaggttgatggagcgcgaccccacctggcgccttctggtggggcagttcagagaaatt
tggcttttccgaattggggtttatttttag

DBGET integrated database retrieval system