KEGG   Meiothermus ruber DSM 1279: Mrub_0370Help
Entry
Mrub_0370         CDS       T01193                                 

Definition
(GenBank) Galactose oxidase
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PA14 DUF1929 Glyoxal_oxid_N GLEYA Kelch_6 Kelch_2 fn3 Kelch_3 Kelch_1
Motif
Other DBs
NCBI-ProteinID: ADD27147
Position
350395..353151
Genome map
AA seq 918 aa AA seqDB search
MKAILALPRVFLLVLALAFLGLTGCNTTRPPATPSNFQATPDATPRVVLRWEAAAGATDY
VLERRTNSGAFAVLGVVTNTDYTDESVDYSTTYTYRLTARNNAAASSPVEQSATTPARPL
AAPDAPSNFQATPDDTPKVVLRWTAPERVARYVLERRTRDGSFATLSSTLPASTTEYTDE
AVGSGTPYTYRLTPYNSAGSGSQATLQTDTPAYSEPGFTQTASSYSFSDDRPAGQDPGIN
PLTSPDLGLDVEYFDNPDLTGLFARRIETNINHTFSGQPPRPGMGPDTFSIRWTGLITAP
ASGTYTFTVLADDGVRLWVNDQLLISAWFDQNLTRRSATISLSAGQAYRIKLEYYNQDAR
GAIKLRWAYPGQSEQVVPPSAFVRHQKARIGYFGPKLPWPTVATHAALLPDGRVMTFHGL
DPVGKGQGDNYRDYSKHASTQVFVWTPGTPTDAQSQARYDNTRTDLFCSGYVLAANGKLY
LAGGNLGYDYTASGGEYGFPAGHKHTNIFDPSTNTWSAGPDMTYGRWYPSVITLPNEEML
IIGGNRDQHNGDGDIYRQDWNTIPDVWNPFTNTLRRLTGAESIDINGNVLINHFYPWVHV
APNGQVFLSGNYEKWFYINTTGQGSLGPVHSSLVDRYYGSSVMYQPGKILILGGGDVQKS
NPPGISRGENSAQVIELNPNNQSISVRNVAPMAYKRTHVNATLMPDGRIFVNGGNEDGIQ
FSNATAVYESEIWSPLTETFKRAAEAQCPRTYHSTALLLLDGTIITMGGGATGGDDLPNL
PECDKTKGNEQKVNQLNAEIYYPPYLHNADGSLASRPVVQSAPDRISYGQSFALTTDVPA
TAVERVTLVAFGAVTHAFNMGQRFIELNFTRTGPNSLQVTAPASPNLATPGFYQLYVLDG
RGVPSEARVVRLRDASLP
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgatattggcccttccgagagtgtttttactggtactggcgctggcttttctc
ggtctgacaggctgtaacaccacccggccccccgcaacgcccagcaactttcaggccacc
cccgacgccaccccccgggtggtgctgcgctgggaggcggccgcaggggccactgattat
gtcctcgaacgcagaacaaacagcggtgctttcgccgttctgggtgtggttaccaatacc
gattacaccgatgaaagcgtggattacagcaccacctacacctaccgcctgaccgcccgt
aacaacgctgccgcgagcagcccggtcgagcagagcgccaccacccctgcccggcccctg
gcagcccccgatgcccccagcaacttccaggccacccccgatgacacccccaaagtggtg
ctgcgttggacggccccggagcgggtagcccgctatgtgctggagcgccgtacccgcgac
ggtagctttgccaccctgagcagtaccctgcccgccagcaccaccgagtacaccgatgaa
gcggtgggcagcggcaccccttacacctaccgtctcaccccctacaacagcgcgggcagc
ggcagccaggccaccttgcaaaccgatacaccagcctacagcgagccgggcttcacccag
accgctagcagctacagcttttccgacgaccgccccgctggacaggatcctggcatcaac
cccctgaccagccccgacctgggcctggacgtggaatacttcgacaaccccgacctcacc
ggcctttttgcccggcgcatagagaccaacatcaaccacaccttctcgggtcagcccccc
cgccccggtatgggccccgacaccttcagcatccgctggacgggcctaattaccgctccg
gcaagcggcacctacacctttaccgtgctggccgacgacggggtgcgcctttgggtcaac
gatcagctcctgatcagcgcctggttcgaccagaacctcacccgccgcagcgccaccatt
tccctgagcgcaggccaggcctaccgcatcaagctcgagtactacaaccaggacgcccgc
ggggccatcaagctgcgctgggcctaccccggccagtccgagcaagtcgtgcccccttcg
gcctttgtgcgccaccagaaggcccgcatcggctactttggccccaaactgccctggccc
accgtagccacccacgccgccctgctgcccgatggccgggtgatgaccttccacggcctc
gacccggtgggtaagggccagggcgataactaccgcgattacagcaaacacgcctccacc
caggttttcgtctggacgcccggcacccccaccgatgcccagagccaggcccgctacgac
aacacccgcaccgaccttttctgctcgggttacgtgctggccgccaacggcaagctctat
ctggccgggggcaacctgggctacgactacaccgccagtggcggtgaatacggatttccg
gctgggcataaacataccaacatcttcgaccccagcaccaacacctggagcgccggcccc
gacatgacctacggccgttggtaccctagcgtgattacccttcccaacgaagaaatgcta
attattgggggcaaccgcgaccagcacaatggggatggggacatatatagacaggactgg
aacaccatacccgatgtgtggaatccttttaccaatactcttcgtcggctgactggggcc
gagtccattgacatcaatggcaacgtgctgatcaaccatttctacccctgggtgcacgtg
gctcccaatgggcaagtatttctctcaggtaactatgaaaaatggttttatatcaacaca
acaggccagggctcgctaggcccggttcacagttcattagtggatcgttactacggctcc
tctgtaatgtaccagccgggaaagattttgatactgggcgggggtgatgttcaaaaaagc
aaccctcctggtataagccgaggagagaactctgcccaggtaatcgaactgaaccccaat
aatcagagcatttcggtgcgtaacgtagcccccatggcctacaaacgcacgcatgtcaac
gctacccttatgccggatgggcgcatctttgtaaacggcgggaatgaggatggtatccag
tttagcaacgcaacagcggtgtacgagagcgagatctggtcgccccttaccgagaccttt
aagcgcgctgccgaggcccagtgtccccgcacctaccactccaccgccctactgctgcta
gatggcaccatcatcaccatgggtggtggggccactggaggtgatgacctacccaacctg
ccagagtgcgataaaaccaagggcaacgagcagaaggtcaaccagctcaacgccgagatc
tactacccgccctacctgcacaatgccgatggcagccttgccagccgtccggtggtgcag
agcgcgccggatcgcattagctacggccagagctttgccctaaccaccgacgtacccgcc
acggcggtggagcgggtgaccctggtggcttttggtgcggtaacccatgccttcaacatg
ggccagcgctttatcgagctaaactttacgcgcactggccccaattccctccaggtgacc
gcgccagccagccccaacctggctacccccggcttttaccagctttatgtgctggatggc
cggggggtgccgtcggaggccagggtggtgcgtctgcgggatgccagcctgccctag

DBGET integrated database retrieval system