KEGG   Meiothermus ruber DSM 1279: Mrub_0373Help
Entry
Mrub_0373         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(355818..356090)
Genome map
AA seq 90 aa AA seqDB search
MESARPYLLKMHTPTNPLKRFEEAPPKSREALLKLWAALGPRVRTADPTRYYAVQEALEL
DIPFPVLVLYVFRECRRALEDNPIQERLAE
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgcccggccctacctgttgaaaatgcacacgcccaccaacccgctcaaacgc
ttcgaggaagccccgccaaagagccgcgaagccttgctcaagctatgggccgcgctgggg
ccccgcgtgcgtaccgccgaccccacacgctactacgctgtgcaggaggcgctcgagctc
gatatacccttcccggtgttggtgctgtacgtgtttcgcgaatgccgccgggccctggaa
gacaaccccatacaagagcgcctggccgagtag

DBGET integrated database retrieval system