KEGG   Meiothermus ruber DSM 1279: Mrub_0374Help
Entry
Mrub_0374         CDS       T01193                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K00329  NADH dehydrogenase [EC:1.6.5.3]
K00356  NADH dehydrogenase [EC:1.6.99.3]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Mrub_0374
Enzymes [BR:mrb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Mrub_0374
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     Mrub_0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 3Beta_HSD Epimerase NmrA RmlD_sub_bind NAD_binding_4 GDP_Man_Dehyd Glyco_transf_4 Pyr_redox NAD_binding_7 KR adh_short NAD_binding_2 Semialdhyde_dh F420_oxidored 3HCDH_N Pyr_redox_2 THF_DHG_CYH_C Glyco_trans_4_4 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ADD27151
UniProt: D3PM40
Position
complement(356137..357036)
Genome map
AA seq 299 aa AA seqDB search
MKVLIVGGSGYVGTHMAQHLLERGHQVTVASRRGEGPLSGVRYVMADAAKNEGLLEAAQG
QEALIYLVGIIRERGDQTFRQAHVDGVRHSLAAAKAAGIARFVHMSALGTARGTGSRYYE
TKAEGEELVQASRLDWTILRPSLIFGQGDEFFGGILKGLVTAPIPFIPLIGDGRFVFRPI
WVGDVAAAFEQALGRPNTIHRSYNLVGPKEYTFRELLLLVRDTLGSRKPLLSIPLTLMDW
VVPLISPLPFSPITRDQYLQLKMGNTADPVHMRHAFALEERSLETELPKILSAKRLVGA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtactgattgtcggcggcagcggctatgtgggcacccacatggcgcagcacctg
ctggagcggggccaccaggtcacggtggcctcgaggcggggggaggggccgctttcgggg
gtgcgctatgtgatggccgatgcggccaaaaacgaggggctgctcgaggccgcccagggc
caggaagcgctcatttacctggtgggcatcattcgcgagcgcggcgaccagaccttccgc
caggcccacgtggatggggtgcggcacagcctggcagccgccaaagcagccggaattgct
cgcttcgtgcacatgtccgcgctgggcaccgcccgcgggacaggcagccgctactacgaa
accaaggccgagggcgaagaactggtacaggcctcgaggctggactggaccattctgcgc
cccagcttgattttcggtcagggcgacgagttttttgggggcattctgaagggcctggtc
accgcccccatccccttcatccccctgattggcgatggccgctttgtcttccggcccatc
tgggtgggggacgtggccgcggccttcgagcaagccctgggccgccccaacaccattcac
cgcagctacaacctggtagggcctaaggaatataccttccgcgagctgctgctcctggta
cgggacaccctgggctcccgcaaacccctgctctccatcccactgaccctgatggactgg
gtagttcccctcatctcccctctgcccttcagccccattacgcgcgaccagtaccttcag
ctcaagatgggcaacaccgccgatccagtccatatgcgccatgctttcgccctggaagaa
cgctcgctcgagaccgaattacccaaaatcctctcagctaaacggttggtcggtgcttaa

DBGET integrated database retrieval system