KEGG   Meiothermus ruber DSM 1279: Mrub_0380Help
Entry
Mrub_0380         CDS       T01193                                 

Definition
(GenBank) addiction module toxin, RelE/StbE family
  KO
K06218  
mRNA interferase RelE/StbE
Organism
mrb  Meiothermus ruber DSM 1279
Brite
Prokaryotic defense system [BR:mrb02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   RelE/StbE-RelB/StbD
    Mrub_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
360516..360785
Genome map
AA seq 89 aa AA seqDB search
MGYRIEFDPRAEGELAKLDREVARRIVRFLRERVASLDDPRSIGEALHGPELGRFWKYRV
GDYRLICHIQDQRVTVLVLRIGHRQVVYR
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
ttgggctacaggattgagttcgacccacgggccgagggagagctggcgaaactggatcgt
gaggtggcgcgtcgcatcgtacggtttttgcgcgagcgggtggcctcgttggatgatccg
cgtagcattggggaggccttgcacgggccggagctgggccggttttggaagtaccgggta
ggggattatcgcctgatctgccatatccaggatcagagggtcactgtgctggtcttgcgg
attgggcatcggcaggttgtctaccgctga

DBGET integrated database retrieval system