KEGG   Meiothermus ruber DSM 1279: Mrub_0384Help
Entry
Mrub_0384         CDS       T01193                                 

Definition
(GenBank) phospholipid/glycerol acyltransferase
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-ProteinID: ADD27161
Position
364836..365525
Genome map
AA seq 229 aa AA seqDB search
MMRPWERLLSVAFKALFRRTVQRGLRGVWVRGALPGQACVLAGNHHSWWDGYLLPVLFWG
GGRPFKIVVGERRLQEFAFFRRLDTVSASKPREALAALGRGEVLIVFPEGELRPPGPLGG
LNRGVVWFAERAGVSVVPVASRVVLRGHELAEAYLVFGAPIEPDLRLLREQLERMLAELD
DQIRTAPAEEPLPGFELRLAGRRSTHERMAAWGAALGKLIGLAERKGAP
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtccctgggaacgattgttaagcgtggccttcaaggccctgtttcgccgcacg
gtgcagcggggcctgcggggggtgtgggtgcggggggccctgccggggcaggcctgtgtg
ctggccggtaaccaccactcctggtgggatggctatctgctgcccgtcttgttttggggg
ggcgggcggcctttcaaaattgtggtgggggagcgccgcttgcaggagtttgctttcttt
cgccgcctcgatacggtctcggccagcaagcccagggaggcgctggccgcccttgggcgg
ggggaggttttgatcgtcttccccgagggtgagctgcgcccgccggggccgctgggcggg
ctgaaccggggggtggtctggttcgccgagcgggcgggggtgtcggtggtgccggtggcc
tcgagggtggtgttgcgcgggcacgagctggccgaggcctatctggtctttggtgcgccc
atagaacccgatttgaggctgctgcgcgagcaactggagcggatgctggccgaactcgac
gaccagatccgcaccgcccccgccgaggaaccactgccgggtttcgaactgcggctggcc
gggcgcaggagcacccacgaacgcatggcggcctggggggcggcgctgggtaaactgatc
gggctggccgagcgtaaaggtgctccgtag

DBGET integrated database retrieval system