KEGG   Meiothermus ruber DSM 1279: Mrub_0391Help
Entry
Mrub_0391         CDS       T01193                                 

Definition
(GenBank) thioesterase superfamily protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_3 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ADD27168
UniProt: D3PM57
Position
372469..372828
Genome map
AA seq 119 aa AA seqDB search
MSEARTLELVFPEHANPGGNAFGGFVLGLMDKVGSYAAIRHARKRCVTVRVGEVVFEVPI
KVGDLLEVVAKVVRVGRTSLTVEVEVYRENLREPKVLATKGNLTYVAVDEHGKPTPVEG
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcccgcaccctggaattggtttttcccgagcacgccaaccccggcggcaat
gcttttggcggttttgttctgggtctgatggataaggtgggctcctatgcagccatccgc
cacgcccgcaagcgctgcgtgacggtgcgggtgggcgaggtggtgttcgaggtgcccatt
aaggtaggcgacctgctggaggtggtggccaaagtcgtgcgggtcggtcgcacctcgctc
acggtcgaggtcgaggtgtaccgcgagaacctacgcgagcccaaggtgctggctaccaaa
ggcaacctcacctatgtggcggtggacgagcatggcaagcccacacccgtcgaggggtag

DBGET integrated database retrieval system