KEGG   Meiothermus ruber DSM 1279: Mrub_0421Help
Entry
Mrub_0421         CDS       T01193                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00520  Amino sugar and nucleotide sugar metabolism
mrb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mrub_0421
Enzymes [BR:mrb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Mrub_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ADD27198
UniProt: D3PMM3
Position
399831..400928
Genome map
AA seq 365 aa AA seqDB search
MAQLVGTLITPSLSYPGRIAFAERIEALEPLDADQGSPERFILPGFIDLHVHGGDGADCM
DGEQAVRRMARFHARHGTTALLATTVTAPLEELEAALRGIAAVVQNPGPGEARVLGVHLE
GPFISPERLGAQPPYALEPSIETMRYLLSLAPIRVVTLAPERPGALELIRFLSEQGVRVQ
QGHTAATYAQALAGFEAGAQGFTHFYNAMTPLHHREPGVVGLGLERARWAEIIPDGLHVH
PAVIRALARAIPQTYAVTDAVAAAGRPEGEYRLGRHRVYKKSQGVFLADGTLAGSALTMD
RAAYNLRCWGYTVPEVMQMTSSFAAQYLGIPHGLEIGQPADLVVLDEQARLVEVYVRGQK
VEVSG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacttgtgggaacactaataacccccagtctttcttatccgggtcgtatagcc
tttgcggagcgcatcgaggccctggagccactggatgccgaccagggcagtccggagcgc
tttattctgccaggctttatagacctacacgtgcacgggggggatggggccgactgcatg
gatggggagcaggccgtgcgacggatggcccgcttccacgcccggcatggcaccaccgcc
ctgctcgccaccaccgttacggcgccgctggaggagctcgaggccgctttgcggggcatc
gctgcggtggtgcagaaccccggccctggtgaggcgcgggtgctgggggtgcatctggag
gggccgtttatcagcccggaaaggctgggggcccagccgccctacgccctcgagcccagc
atcgagaccatgcgctatttgctctccctggccccaattcgagtggtgacgctggccccc
gaacggccaggggcgctcgagctaatccgcttcctgagtgagcagggggtgcgggtgcag
caaggccacacagcggccacctatgcccaggcgctggcgggttttgaggccggggcccag
ggttttacccatttctacaacgccatgacccccctgcaccaccgcgagccgggggtggtg
ggcctgggcctcgagcgcgcccgttgggccgagattattccggacgggctgcacgtgcac
ccggcggtcatccgtgcgctggcccgagccatcccccagacctatgctgtaaccgatgca
gtggctgctgcagggcggcccgagggggagtaccggttggggcggcaccgcgtctacaag
aaaagccaaggggttttcctggccgatggcaccctggctgggagcgcccttaccatggac
agggctgcgtataatctgcgctgctggggctataccgtgcctgaggtgatgcagatgacc
tcgagctttgccgcccagtacctgggaatcccgcatgggctggaaataggccagcccgcc
gacctggtggtgctcgacgagcaggcgcggcttgtggaggtgtatgtgcgaggccagaaa
gtggaggtctctggatga

DBGET integrated database retrieval system