KEGG   Meiothermus ruber DSM 1279: Mrub_0429Help
Entry
Mrub_0429         CDS       T01193                                 

Definition
(GenBank) ornithine cyclodeaminase/mu-crystallin
  KO
K01750  ornithine cyclodeaminase [EC:4.3.1.12]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00330  Arginine and proline metabolism
mrb01110  Biosynthesis of secondary metabolites
mrb01130  Biosynthesis of antibiotics
mrb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mrub_0429
Enzymes [BR:mrb01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.12  ornithine cyclodeaminase
     Mrub_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADD27206
UniProt: D3PMN1
Position
complement(406689..407585)
Genome map
AA seq 298 aa AA seqDB search
MRILTAEETAQALPYPALAQAIAGVLEARAQGTVQAPERLVMPLAGGATLLLMPATDPRI
TVTKLVTVHPQERPSVRAEVWVMRTDTGERLALLDGAVVTARRTAAISLLAAQTLAPHPT
GTLLIIGAGVQARSHLEAFQEGLGTDKVYVYSRHFEHAEALASYARGRGLLAQAVRSLEP
VLEEVRLIVTATTSPTPVLLQAPPGAFIAAVGAYRPEMAEVAPQVVRQARLYVDTLEGAR
SEAGDLLQAGVDWGQVQPLEAALHQPRPASGTVLFKSVGHALWDLAAARLAVQSLGIR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatactcactgccgaagaaaccgcccaggccctcccctacccagccctggcccag
gccatcgccggggtgctcgaggcccgcgcccagggcacggttcaggcccccgagcgcctg
gtgatgccgctcgcgggcggggccaccctgctgctgatgccggccaccgacccccggatc
accgtgaccaagctggtgacggtgcacccccaagagcgccccagtgtgcgggccgaggtc
tgggtgatgcgcaccgataccggcgaacgcctggccctgctggacggcgcggtggtcacg
gcccggcgcaccgcggcgatctcgctgctggcggcccagaccctggccccccaccccacc
ggcaccctgctcatcatcggggcgggtgtgcaggccagaagccacctagaggccttccag
gagggcctgggcaccgacaaggtgtacgtctactcgcgccacttcgagcacgccgaagcc
ctggcctcctacgcccgtgggcgcggcctgctggcccaggccgtgcgcagcctcgagccc
gttctcgaggaggtgcgcctgatcgtcaccgccaccaccagccccaccccggtgctgctg
caagcccctccaggcgctttcatcgccgccgtgggggcctaccgccccgagatggccgag
gtcgccccgcaggtggtgcggcaggcccggctgtacgtggataccctcgagggggcccgt
tcggaggcaggcgacctgctgcaagccggggtggactggggtcaggtgcagccgctcgag
gcggccctacaccagcccagaccggcctcgggtacggtgctgttcaagagcgtgggccac
gcgctgtgggatctggccgcggcccgcctggcggtgcagtcgctgggcatccggtaa

DBGET integrated database retrieval system