KEGG   Meiothermus ruber DSM 1279: Mrub_0437Help
Entry
Mrub_0437         CDS       T01193                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mrub_0437
Enzymes [BR:mrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mrub_0437
Exosome [BR:mrb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mrub_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417621..419183
Genome map
AA seq 520 aa AA seqDB search
MPGTALVLAGFGVFAISAIKTEESMPYILALDQGTTSSRAIVFDLEGQPQAMAQQEFMQH
FPQPGWVEHDPLEIWQTQLQVAQEAIQRAAIQPSEIVALGITNQRETTVLWERATGKPVH
RAIVWQDRRTAPICDELRKGGYEGLFRQKTGLVLDAYFSGTKVKWLLENVPGFRERAGKG
ELCFGTIDSWLIYNLTGGRVHATDVSNASRTLLFNLHTQRWDEELLGILGLPKALLPEVR
PSAGLFGETLPELFGAPIPIAGVAGDQQAALFGQACFTPGMAKNTYGTGCFLLMHTGQEQ
VTSQNGLLTTVAWQLEGGPLEYALEGSVFVAGAVVQWLRDGLGIIQNSSEIEHLARQVSS
TDGVYLVPAFVGLGAPYWDPYARGTVVGLTRGSSKAHLARAALEAIAYQSRDVLEAMEAD
AGLQLSELRMDGGATVNDLLMQFQADILGTPVVRPQVTETTALGAAYLAGVGVGLLTQAQ
IAQRWAVQKRFEPAMGQEERARLYSGWKKAVERAKSWVDA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaacggctttggtgctagccggttttggggtgtttgcgatcagtgcgatcaaa
acggaggagtccatgccctacattcttgccctcgaccagggaaccaccagcagccgggcc
atcgtcttcgatctggaaggccaacctcaggccatggcccagcaggagttcatgcagcac
tttccccagccgggctgggttgagcacgatcctctggaaatctggcagacccagctccag
gtagcccaggaggccatccagcgggcggccattcaacccagcgagattgtggccctcggg
atcaccaaccagcgcgagaccacagtattgtgggagcgggccaccggcaagccggtgcac
cgggccatcgtctggcaggatcgccgtaccgcccccatctgcgatgagctgcgcaagggg
ggctacgagggcctattccgccagaaaaccgggctggtgctggatgcctatttctcaggc
accaaggtcaagtggctgctggagaacgtaccggggttccgggagcgggctgggaagggc
gagctgtgctttggcaccatagatagctggctgatctacaacctgaccgggggccgggta
cacgccaccgacgtctccaatgcctcgcgcaccctgctctttaacctgcatacccagcgc
tgggacgaagagctgctgggcatcctgggccttcccaaggccctgctgccagaggtgcgc
ccctcggcggggctatttggcgagaccctccctgagctgtttggggcccccatcccgatt
gctggggtggcgggcgaccagcaggcggccctgttcgggcaggcctgctttacccccggc
atggctaagaacacctacggtacgggctgctttttgctgatgcacaccgggcaggagcag
gtgacctcgcagaacggcctcttgaccacggtggcctggcagctggaaggagggccgctc
gagtacgccctcgagggctcggtgtttgtggccggggcggtggtgcagtggctgcgagac
ggcctgggtattattcaaaactcgagcgagattgagcatctggcccgccaggtgtccagc
accgacggggtctacctggtgccggcctttgtggggttgggcgcgccctactgggatccc
tacgcccgcggcaccgttgtgggtctgacccgcggctccagcaaagcccacctggcccgg
gccgccctggaggccatcgcctaccagagccgggatgtgctcgaggccatggaggccgat
gctgggctccagctctccgagctgcggatggacgggggggccaccgtcaacgatcttttg
atgcaattccaggcggacatcctgggtaccccggtggtgcggccccaggtgaccgagacc
actgccctgggggccgcctacctggctggggtgggggtgggactgcttacccaagcgcaa
attgcccagcgctgggccgtgcagaagcgttttgagccggccatgggccaggaggagcgg
gcccggctgtatagcggctggaagaaggccgtggaacgggccaaaagctgggtggacgcc
tag

DBGET integrated database retrieval system