KEGG   Meiothermus ruber DSM 1279: Mrub_0449Help
Entry
Mrub_0449         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4388 Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADD27226
Position
435862..436647
Genome map
AA seq 261 aa AA seqDB search
MLSGDLAEFPLLRLLETLMGAARGGVLRIEHPSFVGSIYLEGGHPVHAEAGRLRGLEALE
LLAGLKSAPFCFDSEQNTRERSIEPGLETHQLIVHQFEAWNEVSLPDNWTLTLQACSIQG
PTQLSPLEASVLAQVQGKSLAQALMNERLSPLEAAQVLSKLLRLGLLEARNHLVIEPEPL
VVLTLYGGGQGVAAIDEELFARWQGLVGEGFVLRLRTKNQEATLRPQPRINMQGRVGLFE
RDLRQLRLSRGVLVEVWPEAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgctaagtggagacctggcagagttcccccttttgcggctcttggagaccctaatgggg
gcggccaggggtggggttttacgcatcgagcaccccagttttgtgggcagtatctacctc
gagggcgggcacccggtacacgccgaggccggtaggctgcggggtttagaggccttggag
ctgctggctggcctcaaatcggcgccgttttgcttcgattctgagcagaatacccgtgag
cgcagcattgagcctggcctcgagacccaccagctcattgtgcatcagtttgaagcctgg
aacgaggtcagcctgcccgataactggacgctgacgcttcaagcctgctcgattcagggg
ccaacccagctcagccccctcgaggccagcgttttggcccaggtacaggggaaaagcctg
gcccaggccttgatgaacgagcggctttcgcccctcgaggccgctcaggtgctcagcaaa
ctgctgcggttgggcttgctcgaggcccggaaccacctggtaattgagccggagcctttg
gtggtgctcactctgtatggtggggggcagggggtggccgccatcgacgaggagctgttt
gcgcgctggcagggcctggtaggggagggctttgtgttgcgcttgcgcactaaaaaccag
gaagccaccctgcgcccgcaaccccgcatcaacatgcagggccgggttgggttgttcgag
cgtgatctgcgccaactgcgcctcagccggggcgtattggtggaagtctggccggaggcc
aggtag

DBGET integrated database retrieval system