KEGG   Meiothermus ruber DSM 1279: Mrub_0454Help
Entry
Mrub_0454         CDS       T01193                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mrb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
440189..441016
Genome map
AA seq 275 aa AA seqDB search
MELLAPAKVNLGLSVLGRRPDGYHELHTLFAALRVGDRLWVEAIPEGIELEVWGRGLPAD
TNNLVYKAAQAYLTAAGWPGGVRVVLEKNLPLAAGLGGGSSDAAAVLRALSQLYPSALEL
PGLALGLGADVPFFLGPGLAEGRGVGERLTPLPPIRAALVLVNPGIAVSAAEAYKGLTPE
MWQPELDVAGVVEAIQVGEEPPYWNTLERSVFRLHPYLEALKQELYRLGLRGVLMSGSGS
TLFGLARDGAEAGYLAGVLRDKHPGFWVVATETVS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaactgctagccccggccaaggtgaacctgggtctttcggtgctgggccgccgcccc
gacggctaccacgaattgcacaccctgtttgcagccctgcgggtgggcgaccgcctctgg
gtggaggccattcccgagggaattgagctggaggtgtggggcaggggcctgcccgctgat
accaacaacctggtatacaaggcggcgcaggcttacctgacggctgctggctggcccggt
ggggtgcgggtggtactggaaaagaacctgcccctggccgcggggctgggtgggggttcc
tccgatgcggcggcggtgctgcgggctttatcccagctctatccatccgccctcgagctg
ccggggctggcccttgggctgggggccgacgtgccctttttcctggggccgggcctggcc
gaagggcggggggtgggtgaacgactgacccccctgccgcccatccgggctgcgctggtg
ctggtgaacccgggcattgcggtttcggcggctgaggcctacaagggccttacacccgag
atgtggcagcccgaactggatgtggcgggggtggtggaagccatacaggtgggggaggag
cccccttactggaatacgctcgagcgctccgtatttcgcctgcacccctacctcgaggcc
ctcaaacaagagctgtaccgcctggggctcaggggcgtgctgatgtcgggctcgggttct
accctgtttgggctggcccgtgatggggccgaggccgggtatctggctggggtgctgcgg
gataagcaccctgggttctgggtggtcgctaccgagaccgtaagctaa

DBGET integrated database retrieval system