KEGG   Meiothermus ruber DSM 1279: Mrub_0493Help
Entry
Mrub_0493         CDS       T01193                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_0493
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrub_0493
   00052 Galactose metabolism
    Mrub_0493
   00500 Starch and sucrose metabolism
    Mrub_0493
   00520 Amino sugar and nucleotide sugar metabolism
    Mrub_0493
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mrub_0493
   00524 Butirosin and neomycin biosynthesis
    Mrub_0493
Enzymes [BR:mrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mrub_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(480931..481833)
Genome map
AA seq 300 aa AA seqDB search
MSVVGIDLGGTKIMAGVFSEGVIKTKVTVPTPEEGGQAVIEAMAQAAKAAIEASGVAVQA
IGLGTPGPLDFKRGRIKFAPNIANFTDFPIVERLEQATGYKVYMENDANAAALAEHKLGA
AQGAESTLYMTVSTGVGGGFVWGNKVLRGVNGQGGEIGHITMQPGGPSCGCGLDGCLEAL
ATGPAMERMALASFKREMNTRELFALFQQGDPRASRIVLQAASWVGIALASLVKCYDPEV
VVLGGGVALNAGPAYLEEVQRSYQRYMENWITPPLHLAKLGSEAGLLGAALTAAIEVGEL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagtgggaattgatctaggcggaaccaagatcatggccggggtgttcagcgag
ggcgtgattaagaccaaggtgaccgtacccacgccagaagaaggcggccaggccgtgatc
gaggccatggcccaggctgccaaggcggccatcgaggcctcgggcgtggcggtgcaggcc
atcggcctgggcacgccggggcccctcgacttcaagcggggccggatcaagtttgctccc
aacatcgccaactttaccgatttccccattgtggagcggctcgagcaggccaccggctac
aaggtctacatggaaaacgacgccaacgccgcggccctggccgagcacaagctgggggcc
gcccagggcgccgaaagcaccctctacatgacggtctcgaccggggtagggggcggcttt
gtctggggcaacaaggtgctgcgcggcgtaaacgggcagggaggcgagatcgggcacatc
accatgcagccgggcggcccctcgtgcggctgcggactggatggctgcctcgaggccctg
gccaccggcccggccatggagcgcatggccctggcctccttcaagcgcgagatgaacacc
cgcgagctgttcgcgctgttccagcagggcgacccccgggccagccgcatcgtgctgcag
gccgcaagctgggtgggcatcgcgctggcctcgctggtcaagtgctacgaccccgaggtg
gtggtgctggggggtggggtggccctcaacgcagggccggcctacctcgaggaggtgcag
cgcagctaccagcgctacatggagaactggatcaccccacccctccacctggccaagctg
ggcagcgaggccgggctgctgggggcggccctgaccgcggccatcgaggtgggtgagctc
tag

DBGET integrated database retrieval system