KEGG   Meiothermus ruber DSM 1279: Mrub_0579Help
Entry
Mrub_0579         CDS       T01193                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mrb  Meiothermus ruber DSM 1279
Brite
Enzymes [BR:mrb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Mrub_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(547190..549865)
Genome map
AA seq 891 aa AA seqDB search
MKIKFESNQEYQLEAIQAVTGVFEGQPLSEGLYTLGMESDELYGIAAYANGLLLSPEALL
ENVRRVQEANGLEPSDRLEAIEIPDSGIALNFSVEMETGTGKTYVYLRTIYELHRLYGFK
KFIVAVPSVAIREGVLSNLRLTKEHFDTLYGNVPVDYWVYDSKQVSRLRSFATENTLQIL
IINIDAFNKPSNNVIFLPNDRLSGFCPIEFIRAAHPIVIVDEPQNFESNLAKRALASLNP
LCTLRYSATHRNPYNLLYRLDPVRAYDLGLVKQIEVTSVLEEENFNVPYLKLKEVKATKS
SISAKVELDVWDGSAAKRKSVTLKQGSDLYELSGGRELYRGYVVDEIDAGFKYVSFANGV
RLEEGQEQGVNADELMRAQIRETVREHLNKELAVARLPEGQRLKVLSLFFIDRVANYRGE
DAKFRRWFEEAYHELSSLPVYASLNLPPVEQVHGGYFAEDKTGWKDTSGNTQADEEAYEK
IMRDKERLLSLEEPLRFIFSHSALREGWDNPNVFQICTLNETRSEVKKRQEIGRGLRLPV
RENGERSFDARINRLTVIANESYKDFAKALQTEIEEETGLDFGQERIKNSRERRTLKLKK
GWELNEDFRALWERIKHHTRYRVEFDTEDLVQRAAKAIREMPKVERPRYRIEKGRIVRLG
EDLETALVRVNTEDLDFRPAVPDLLAYLQRETELTRGTLARILKESGRLADAKENPQQFI
DLALAAIRNTLGELMVEGIKYERLEGQAYDMMLFESKELIGYLDKIVEVSNSIYDGVIFQ
SEVERGFAEALDKREDVKLFVKLPDWFEVDTPLGKYRPDWAVVMVDGEQEKLYFICETKG
SKDMTKLRVSERLKIESGRAHFQALEVPYVVETSAAELSPERVRSSFKSSE
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaagttcgagagcaaccaggagtaccagctcgaggccatccaggcagtgacg
ggggtattcgaagggcaacccttgagcgaggggctctacaccctgggcatggagtccgac
gaactatatggcatcgccgcctacgccaacgggctgctgctcagcccagaggccctgctg
gagaacgtccgccgggtgcaggaggccaacgggctggaaccgagcgatcggctcgaggcc
atcgaaatccccgatagcggcatcgcgctcaacttctcggtagagatggagaccgggact
ggcaagacctacgtctacctccgcaccatctacgagctgcaccgcctctacggcttcaag
aagttcatcgtcgccgtgcccagcgtcgccatccgggagggggtgctctcgaatctgcgc
ctcaccaaagagcatttcgacaccctctacggcaacgtgccggtggactactgggtctac
gactccaaacaggtctcacggctgcgctccttcgctaccgagaacaccctgcaaatcctt
atcatcaacattgatgccttcaacaaaccgagcaacaacgtgatctttctccccaatgac
cggctttcgggcttctgccccatcgaattcatccgggcggcgcacccgatcgtcatcgtg
gacgagccgcagaacttcgagagcaacctggcgaaacgagccctggcgagcctgaatccc
ctctgcacgctgcgttactcagccacccaccgcaacccctacaacctgctttaccggctc
gacccggtacgggcctacgacctcgggctggtcaagcagatcgaggtgacgtcggtgctc
gaggaggagaacttcaacgttccctacctgaagctgaaggaagtcaaggccaccaaaagc
agcatcagcgctaaggtagagctcgacgtttgggacgggagtgccgccaagcgcaaatcc
gtgaccctcaagcagggctccgacctctacgagctgtcgggggggcgggagctgtaccgg
ggctacgtggtggacgagatcgacgcgggcttcaagtacgtgagcttcgccaacggggtg
cgcctggaggaggggcaggaacaaggagtcaacgccgatgagctgatgcgggcgcagatc
cgagaaaccgtgcgcgaacacctgaacaaggaactcgccgtcgcgcggctgccggagggc
cagcgcctcaaggtgttgtccctgtttttcatcgaccgggtagccaactaccggggcgaa
gacgccaagtttcggcgctggttcgaggaggcctaccacgaactttcgtcactcccggtc
tacgcctccttgaaccttcccccggtggagcaggtgcacgggggctacttcgccgaggac
aagacaggatggaaggacacctcgggcaatacccaggccgacgaggaggcctacgagaag
atcatgcgcgataaggagcggctgttgtcgctggaggagcccttgcgcttcatcttcagc
cactcggccttgcgcgagggctgggacaaccccaacgtgttccagatctgcacgctcaac
gagacccgctccgaggtcaagaaacgccaggagatcgggcggggcctgcgcctgccggtg
cgcgagaacggggaacgatcgttcgacgcccggatcaatcggctgaccgtcatcgccaac
gagagctacaaggacttcgctaaggccctgcagaccgaaatcgaggaggagaccggcctt
gactttgggcaggagcgtatcaaaaacagccgcgagcggcgcaccctcaagctcaagaag
ggctgggagctcaacgaggacttccgcgcgctttgggaacggatcaagcaccacacccgc
taccgggtggagttcgacaccgaggacctcgtgcagcgggccgccaaggccatccgtgag
atgccaaaggtcgagcgcccgcgctaccgcatcgaaaaggggcgcatcgtccggcttggc
gaagacctcgagaccgcactcgtcagggtcaacaccgaagacctggacttccgccccgcc
gtccctgacctgctggcctaccttcagcgcgagaccgagctgactcgcggcaccctggcc
cgcatcctcaaggagtcggggcggctggcggatgccaaggagaacccccaacagttcatc
gacctagccctagccgccatcaggaacaccctcggggagctgatggtggagggcatcaag
tacgaacggctcgagggacaggcctacgacatgatgctcttcgagagcaaggaactcatt
ggctacctggacaaaatcgtcgaggtgagcaattccatctacgacggggtgatcttccag
tcggaggtcgagcggggcttcgccgaagccctggacaagcgcgaggatgtgaagctcttc
gttaagctccctgactggttcgaggtggacaccccgctcggcaagtaccgccccgactgg
gccgtggtcatggtagatggcgagcaggagaagctctacttcatctgcgagaccaagggc
agcaaggacatgactaagctgcgcgtcagcgagcgcctcaagatcgagagcggcagggcc
catttccaggcgctcgaggttccttacgtcgtagaaacctccgcggctgaactgagccct
gagcgcgtccgatcaagcttcaaaagtagcgaatga

DBGET integrated database retrieval system