KEGG   Meiothermus ruber DSM 1279: Mrub_0615Help
Entry
Mrub_0615         CDS       T01193                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_0615
   01230 Biosynthesis of amino acids
    Mrub_0615
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrub_0615
   00030 Pentose phosphate pathway
    Mrub_0615
   00051 Fructose and mannose metabolism
    Mrub_0615
   00052 Galactose metabolism
    Mrub_0615
  Energy metabolism
   00680 Methane metabolism
    Mrub_0615
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mrub_0615
Enzymes [BR:mrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mrub_0615
Protein phosphatases and associated proteins [BR:mrb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mrub_0615
Messenger RNA biogenesis [BR:mrb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mrub_0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
594559..595527
Genome map
AA seq 322 aa AA seqDB search
MKRIAVFTSGGDAPGMNAAIRAVVRTGVAHGLEVIGIRGGYQGMIEGDFIPMGPRDVANT
LQRGGTILLTARSKEFMTPEGRARAAENLKKAGIDGVIAIGGNGTYAGAAKLLAEHHIPV
VGAPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHSRVFFIEVMGRHAGFIALE
VGIAGGAEVIVIPEIPTNAQACAEVINKSAEKGKRSSIVVVAEGGYEGGAEQLAKDVRQY
SGFDARVTVLGHIQRGGSPTAKDRVLASRLGAACVEALLSGASGVAIGEVNDEIRLTPFK
EAIEKRKDINHKKYELAKVLAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaattgcggtttttaccagtggaggcgacgcgcccggcatgaatgccgccatc
cgggcggtggtgcgtacgggggtggcccacggcctggaggttatcggcatccggggtggc
tatcagggcatgatcgagggtgactttataccgatggggccgcgggatgtggccaacacc
ctgcagcgggggggcaccattctgctcaccgcccgcagcaaggagttcatgacccctgaa
ggccgggccagggccgctgaaaacctcaaaaaggccggcatagatggggtgatcgccatt
ggcggcaacggcacctacgccggcgcggcgaagctgctggccgaacaccacattccggtg
gtgggcgcgcccggcaccattgacaacgacctctacggcaccgattacaccatcggcttt
gatacggcggtgaacaccgccctggaagccattgaccgcatccgcgataccgcggccagc
cactcgagggtcttctttatcgaggtgatgggccgccatgcgggttttattgccctggaa
gtgggcattgccgggggggccgaggtaatcgtgattcctgagatacccaccaacgcccag
gcttgcgctgaagtgatcaataagtcggcggagaagggcaagcgctcctccattgtggtg
gtggccgagggcggctacgagggcggcgccgagcagttggccaaagatgtacggcagtac
tcgggtttcgacgcgcgggttacggtgctgggccacatccagcgcggcggtagccccacc
gccaaagaccgggtgctggccagccgcctgggagccgcctgcgtggaagcccttctaagc
ggggccagcggggttgcgattggcgaagtgaacgacgaaatccgtctcacccccttcaag
gaagccatcgagaagcgtaaggatatcaaccacaagaaatacgagctggccaaagtgctg
gccctgtga

DBGET integrated database retrieval system