KEGG   Meiothermus ruber DSM 1279: Mrub_0766Help
Entry
Mrub_0766         CDS       T01193                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mrub_0766
  Amino acid metabolism
   00340 Histidine metabolism
    Mrub_0766
Enzymes [BR:mrb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mrub_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(747632..748879)
Genome map
AA seq 415 aa AA seqDB search
MIKTPEQIHEHFKNRRLTVEYGDALETVRSILHQVEHEGDTALQRISQEIDGHPVEEIPK
RVWREAYENLDADLRDALETAKERIEAFYRREPMGGFLEAGTDGVLGQLVRPLDRVGVYV
PGGSAPLLSTVLMTAVPAKVAGVGEIVLASPPRVHPGILAAAWVAGADRLFAMGGAQAIA
ALAYGTETIPRVDKIVGPGNRYVVLAKREVYGSVGMEGLPGPTETLIIADASADPKLLAA
DLLAQAEHGPDSEAWLLSSYRELLERVEEELQRQLADLPRASIARQALQRSGLVQVESIE
QALELANLYAPEHLCLSVNDPLAVLGQVRNAGGIFLGEHSCEALGDYIAGPSHVMPTAGT
ARFGGGLALRDFLKVIPVVGLNQAAAGKLAALGARMAREEGLEAHARALDRRAKG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaacccctgagcagatccacgaacacttcaaaaaccgccgcttgaccgtagag
tatggcgatgcgctggagacggtgcggtcgattttgcaccaggtcgagcacgagggcgac
acggccttgcaacgcatcagccaggagatagacgggcatcccgtggaagaaattcccaag
cgggtctggcgcgaggcctacgaaaacctggatgccgacctacgggacgccctcgagacc
gccaaagaacgcatcgaggccttctaccggcgggagcccatgggcggcttcctggaggcc
ggcaccgatggggtgctgggccagttggtgcgcccgctggatcgggtgggggtgtatgtg
ccgggggggtcggccccgctgctttccacggttttgatgaccgcggtgccagccaaggtc
gccggggtgggcgagatcgtgctggcctccccccctcgagttcatccaggcattctggcc
gcagcctgggtggccggggccgaccggctgtttgccatggggggcgcccaggccatcgca
gcgctggcctacggcaccgagaccataccccgggtcgacaagatcgtgggcccgggcaac
cgctatgtggtgctggctaaacgcgaggtatacgggtcggtgggcatggaaggcctgccg
gggccgaccgaaaccctgatcatcgccgatgcctccgccgatcccaagctgctggccgcc
gacctgctggcccaggccgaacacggcccagactccgaagcctggctgctttcgtcctac
cgggagctgctggaacgtgtggaggaagagctccagcgccagctagccgacctgccacgg
gccagcatcgcccgccaggccctgcagcgaagcggtctggtgcaggtagaaagcatcgaa
caggccctcgagctcgccaacctctacgcccccgaacacctgtgcctttccgtgaacgac
ccgctggccgtgctggggcaggtgcgcaacgcgggaggaatttttctgggtgaacattcc
tgcgaggccctgggcgactatatcgccggccccagccacgtcatgcccacagccggcacc
gcccgctttggcggtgggctggccctgcgggactttctcaaggtcatcccggtggtgggt
ctcaaccaggcggcagccggcaagctggccgcgctcggggcccgcatggcccgcgaagag
ggcctggaggcccacgcccgggccctggatcgcagggccaaggggtag

DBGET integrated database retrieval system