KEGG   Meiothermus ruber DSM 1279: Mrub_0768Help
Entry
Mrub_0768         CDS       T01193                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_0768
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mrub_0768
Enzymes [BR:mrb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mrub_0768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
750000..751295
Genome map
AA seq 431 aa AA seqDB search
MSKLTPEMKLEAEKLRREWETNPRWKGIKRDYTAEDVVRLRPSLLPEQTLAKAGAERLWE
LLHTRPYVNTFGAYTGAQAVQMVKAGLEAIYLSGWQVAADANLAWQTYPDQSLYPANSVP
QVVRRINNALQRADQIERAEGKTDRYWYAPIVADAEAGFGGPLNAFELMKAMIEAGAAGV
HWEDQLSSEKKCGHLGGKVLIPTSQHIRTLNAARLAADVMNVPSIIICRTDAEAATLLTS
DIDERDKPFVKEGERTPEGFYRIRNGLEACITRSLAYAPYADLLWMETSTPDLEVARKFA
EAIHAVYPGKMLAYNCSPSFNWKKNLDDETIAKFQRELGAMGYKFQFITLAGWHNLNYRT
FELARNYKERGMSAFVELQQLEFAAEKDGFTAVKHQREVGAGYFDEVLMAITAGQASTAA
LVGSTEEAQFH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactgacccccgagatgaaactggaagccgaaaaactccgccgtgagtgggag
accaatccccgctggaagggcatcaagcgcgactacaccgccgaggatgtggtgcgcctg
cgccccagcctgctgcccgagcagaccttagccaaagcaggggctgaacggctgtgggag
cttttgcacacccgcccctacgtgaacacctttggggcctacaccggggcccaggcggtg
cagatggttaaggccggcctcgaggccatctacctctcgggctggcaggtggccgccgac
gccaacctggcctggcagacctaccccgaccagtcgctctacccggccaactcggtgccg
caggtggtgcgccgcattaacaacgccctgcaacgggccgaccagatcgagcgcgccgag
ggtaaaaccgaccgctactggtacgcccccatcgtggccgatgccgaggccgggtttggt
gggcccctgaacgctttcgagttgatgaaggccatgatcgaagcgggcgcggccggggtg
cactgggaagaccagctcagcagcgagaagaagtgcggacacctgggcggcaaggtgctg
attcccacctcgcagcacatccgcaccctgaacgccgcccggctggccgccgacgtgatg
aacgtgcccagcatcatcatctgccgcaccgatgccgaggccgcgaccctgctcaccagc
gacattgacgagcgcgacaagccctttgtgaaggaaggcgagcgcacccccgagggcttc
taccggattcgcaacggcctcgaggcctgcattacccgctcgctggcctacgccccctac
gccgatttgttgtggatggagaccagcacccccgacctggaggtagcccgcaagtttgcc
gaggccatccatgcggtctaccccggtaagatgctggcctacaactgctctcccagcttc
aactggaaaaagaacctcgacgacgagaccatcgccaagttccagcgcgagctgggggcc
atgggctacaagttccagttcatcaccctggccggctggcacaacctcaactaccgcacc
ttcgagctggcccggaactacaaagagcgcggcatgagcgccttcgtggagctgcagcag
ctcgagttcgccgccgaaaaggacggctttaccgcggtcaagcaccagcgcgaggtgggt
gcgggctacttcgacgaggtgctcatggctattaccgccggacaggcctctacggcggcc
ctggtgggctcgaccgaggaagcccagttccattga

DBGET integrated database retrieval system