KEGG   Meiothermus ruber DSM 1279: Mrub_0768Help
Entry
Mrub_0768         CDS       T01193                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_0768
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mrub_0768
Enzymes [BR:mrb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mrub_0768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
750000..751295
Genome map
AA seq 431 aa AA seqDB search
MSKLTPEMKLEAEKLRREWETNPRWKGIKRDYTAEDVVRLRPSLLPEQTLAKAGAERLWE
LLHTRPYVNTFGAYTGAQAVQMVKAGLEAIYLSGWQVAADANLAWQTYPDQSLYPANSVP
QVVRRINNALQRADQIERAEGKTDRYWYAPIVADAEAGFGGPLNAFELMKAMIEAGAAGV
HWEDQLSSEKKCGHLGGKVLIPTSQHIRTLNAARLAADVMNVPSIIICRTDAEAATLLTS
DIDERDKPFVKEGERTPEGFYRIRNGLEACITRSLAYAPYADLLWMETSTPDLEVARKFA
EAIHAVYPGKMLAYNCSPSFNWKKNLDDETIAKFQRELGAMGYKFQFITLAGWHNLNYRT
FELARNYKERGMSAFVELQQLEFAAEKDGFTAVKHQREVGAGYFDEVLMAITAGQASTAA
LVGSTEEAQFH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactgacccccgagatgaaactggaagccgaaaaactccgccgtgagtgggag
accaatccccgctggaagggcatcaagcgcgactacaccgccgaggatgtggtgcgcctg
cgccccagcctgctgcccgagcagaccttagccaaagcaggggctgaacggctgtgggag
cttttgcacacccgcccctacgtgaacacctttggggcctacaccggggcccaggcggtg
cagatggttaaggccggcctcgaggccatctacctctcgggctggcaggtggccgccgac
gccaacctggcctggcagacctaccccgaccagtcgctctacccggccaactcggtgccg
caggtggtgcgccgcattaacaacgccctgcaacgggccgaccagatcgagcgcgccgag
ggtaaaaccgaccgctactggtacgcccccatcgtggccgatgccgaggccgggtttggt
gggcccctgaacgctttcgagttgatgaaggccatgatcgaagcgggcgcggccggggtg
cactgggaagaccagctcagcagcgagaagaagtgcggacacctgggcggcaaggtgctg
attcccacctcgcagcacatccgcaccctgaacgccgcccggctggccgccgacgtgatg
aacgtgcccagcatcatcatctgccgcaccgatgccgaggccgcgaccctgctcaccagc
gacattgacgagcgcgacaagccctttgtgaaggaaggcgagcgcacccccgagggcttc
taccggattcgcaacggcctcgaggcctgcattacccgctcgctggcctacgccccctac
gccgatttgttgtggatggagaccagcacccccgacctggaggtagcccgcaagtttgcc
gaggccatccatgcggtctaccccggtaagatgctggcctacaactgctctcccagcttc
aactggaaaaagaacctcgacgacgagaccatcgccaagttccagcgcgagctgggggcc
atgggctacaagttccagttcatcaccctggccggctggcacaacctcaactaccgcacc
ttcgagctggcccggaactacaaagagcgcggcatgagcgccttcgtggagctgcagcag
ctcgagttcgccgccgaaaaggacggctttaccgcggtcaagcaccagcgcgaggtgggt
gcgggctacttcgacgaggtgctcatggctattaccgccggacaggcctctacggcggcc
ctggtgggctcgaccgaggaagcccagttccattga

DBGET integrated database retrieval system