KEGG   Meiothermus ruber DSM 1279: Mrub_0768Help
Entry
Mrub_0768         CDS       T01193                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mrb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mrb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
750000..751295
Genome map
AA seq 431 aa AA seqDB search
MSKLTPEMKLEAEKLRREWETNPRWKGIKRDYTAEDVVRLRPSLLPEQTLAKAGAERLWE
LLHTRPYVNTFGAYTGAQAVQMVKAGLEAIYLSGWQVAADANLAWQTYPDQSLYPANSVP
QVVRRINNALQRADQIERAEGKTDRYWYAPIVADAEAGFGGPLNAFELMKAMIEAGAAGV
HWEDQLSSEKKCGHLGGKVLIPTSQHIRTLNAARLAADVMNVPSIIICRTDAEAATLLTS
DIDERDKPFVKEGERTPEGFYRIRNGLEACITRSLAYAPYADLLWMETSTPDLEVARKFA
EAIHAVYPGKMLAYNCSPSFNWKKNLDDETIAKFQRELGAMGYKFQFITLAGWHNLNYRT
FELARNYKERGMSAFVELQQLEFAAEKDGFTAVKHQREVGAGYFDEVLMAITAGQASTAA
LVGSTEEAQFH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactgacccccgagatgaaactggaagccgaaaaactccgccgtgagtgggag
accaatccccgctggaagggcatcaagcgcgactacaccgccgaggatgtggtgcgcctg
cgccccagcctgctgcccgagcagaccttagccaaagcaggggctgaacggctgtgggag
cttttgcacacccgcccctacgtgaacacctttggggcctacaccggggcccaggcggtg
cagatggttaaggccggcctcgaggccatctacctctcgggctggcaggtggccgccgac
gccaacctggcctggcagacctaccccgaccagtcgctctacccggccaactcggtgccg
caggtggtgcgccgcattaacaacgccctgcaacgggccgaccagatcgagcgcgccgag
ggtaaaaccgaccgctactggtacgcccccatcgtggccgatgccgaggccgggtttggt
gggcccctgaacgctttcgagttgatgaaggccatgatcgaagcgggcgcggccggggtg
cactgggaagaccagctcagcagcgagaagaagtgcggacacctgggcggcaaggtgctg
attcccacctcgcagcacatccgcaccctgaacgccgcccggctggccgccgacgtgatg
aacgtgcccagcatcatcatctgccgcaccgatgccgaggccgcgaccctgctcaccagc
gacattgacgagcgcgacaagccctttgtgaaggaaggcgagcgcacccccgagggcttc
taccggattcgcaacggcctcgaggcctgcattacccgctcgctggcctacgccccctac
gccgatttgttgtggatggagaccagcacccccgacctggaggtagcccgcaagtttgcc
gaggccatccatgcggtctaccccggtaagatgctggcctacaactgctctcccagcttc
aactggaaaaagaacctcgacgacgagaccatcgccaagttccagcgcgagctgggggcc
atgggctacaagttccagttcatcaccctggccggctggcacaacctcaactaccgcacc
ttcgagctggcccggaactacaaagagcgcggcatgagcgccttcgtggagctgcagcag
ctcgagttcgccgccgaaaaggacggctttaccgcggtcaagcaccagcgcgaggtgggt
gcgggctacttcgacgaggtgctcatggctattaccgccggacaggcctctacggcggcc
ctggtgggctcgaccgaggaagcccagttccattga

DBGET integrated database retrieval system