KEGG   Meiothermus ruber DSM 1279: Mrub_0973Help
Entry
Mrub_0973         CDS       T01193                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ADD27738
UniProt: D3PQK5
Position
complement(962785..963552)
Genome map
AA seq 255 aa AA seqDB search
MKVALVHLATLETPEATLQKALELLSQAHQQGAKVAVLPELFPSGYRFADAAFTPSVLAR
LEQFCAQTGLSVVAGVLEQAGPRHANRARVVGPAGVLATYTKTHLIPAFGEPETMIPGQE
LVTLELEGFKVGLAICFDLRFPELFRVYALQGVNLFLIPSAWPKSRGYAWELFCKSRAAE
NQAYLVAVNHAENPFGAASLAVDPLGQELLRVEAEGLGLVELDPAFPARLRQEFPVFPQR
RPELYQGLLKSPTSK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgccctggttcacctagccaccctcgagacccccgaggccacgctgcaaaag
gccctcgagctcctttcgcaagcccaccagcaaggcgcaaaggtggccgtactgcccgag
ctcttccccagcggctaccgcttcgccgacgccgcctttacccccagcgtgctggcccgg
ctcgagcagttctgcgcccagaccggtctgagcgtggtggccggggtgctggagcaggcc
ggcccgcgccacgccaaccgggccagggtggtggggccggctggggtgctggcaacctac
accaaaacccacctgatccccgctttcggcgagcccgagaccatgattccgggacaggag
ctggttacgctcgagctggagggtttcaaggtgggcctcgccatctgcttcgacctgcgc
ttccccgagctcttccgcgtctatgcgctgcaaggcgtcaacctgttcctgattccttcg
gcctggcccaagagccgcggctacgcctgggagcttttctgcaaatcccgcgccgccgaa
aaccaggcctacctggtggccgttaaccacgccgaaaaccccttcggggcggccagcctg
gccgtggaccccctgggccaggagctgctgcgggtcgaagctgagggccttgggctggtc
gagctagacccggccttcccggcccggctgcgccaggagttcccggtctttccccagcgc
cgacccgagctgtatcagggccttctgaaaagccccaccagcaaataa

DBGET integrated database retrieval system