KEGG   Meiothermus ruber DSM 1279: Mrub_0984Help
Entry
Mrub_0984         CDS       T01193                                 

Definition
(GenBank) protein of unknown function DUF1385
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1385
Motif
Other DBs
NCBI-ProteinID: ADD27749
Position
complement(975718..976665)
Genome map
AA seq 315 aa AA seqDB search
MVRMKFGLPGIKLFRKLGFFLNQAALGGSAALEGVMMKAADAWALAVRLPNGQIHVERHE
EEALTKKYPWARLPLIRGVVALWDAMSISYKSLSRSAELAGEEDEKVSGAAMYGTLAVSL
VIGLALFVWLPARLAGLLVDEERFRFLFYVVAGLFETAILISYLVFIGRMKDMQRFFMYH
GAEHKAIAAHEKGLELTVENVRAQPAYHPRCGTSFIAFTAVVGVFVYSFFPPLTVAWYWI
FPRLLMIPVVAAVSFEVLRYSAAHHDPLSRFFRWLGFKFQMLTVREPTDDMIEVAIESTK
AALAQQPAEKPVAVA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggttcggatgaagtttggattacccggcataaaacttttccgcaaactgggttttttt
ctcaatcaggccgctctagggggtagcgcggccctcgagggcgtgatgatgaaggccgcc
gacgcctgggccctggcggtgcggctgcccaacgggcagattcacgtagagcgacacgag
gaagaggccctgaccaaaaagtacccctgggcccggctgcccctcatccggggcgtggtg
gcgctgtgggatgccatgagcatctcctacaagtcgctgtcgcgcagcgccgaactggcc
ggggaagaagacgagaaggtctcgggggcggccatgtacggcaccctggcggtctcgctg
gtgatcggcctggctttgtttgtgtggctgccggcccggctggcgggtttgctggtggac
gaggagcgcttccgctttttgttttacgtggtggccgggctgttcgagaccgccattctg
attagctatctggtgtttatcggacgcatgaaggatatgcagcgcttcttcatgtaccac
ggggccgagcacaaggccatcgccgcgcacgagaagggcctcgagctcaccgtggaaaac
gtgcgggcccagccggcctaccacccccgttgcggcaccagcttcatcgccttcaccgcg
gtggtgggggtgttcgtgtacagcttcttcccacccctcacggtggcctggtactggatt
ttcccgcgccttctgatgattccggtggtggccgcggtctccttcgaggtgctgcgctac
tccgccgcccaccacgaccccctctcgaggttcttccgctggctgggcttcaagttccag
atgctcaccgtccgggaacccaccgacgatatgatcgaggtcgccatcgagagcaccaag
gccgccctggcccagcaacctgccgaaaagcccgtagcggtggcctga

DBGET integrated database retrieval system