KEGG   Meiothermus ruber DSM 1279: Mrub_0986Help
Entry
Mrub_0986         CDS       T01193                                 

Definition
(GenBank) purine or other phosphorylase family 1
  KO
K11783  futalosine hydrolase [EC:3.2.2.26]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00130  Ubiquinone and other terpenoid-quinone biosynthesis
mrb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Mrub_0986
Enzymes [BR:mrb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.26  futalosine hydrolase
     Mrub_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: ADD27751
UniProt: D3PQL8
Position
complement(977313..977981)
Genome map
AA seq 222 aa AA seqDB search
MPTLPLLLLSPTRLEAPFLKGQKFDFHGRAGLRGAGWVWLECGIGKVNTAATLAAFVQRR
RFERVLLFGIAGAYADSGLQLGDCALAEREIQADLGVRDGGLKGLGFPSLVVASRPYHNR
FPLDKAFTDELKSKLGLPGKQFLTRDLVSENPTEAHQLARKWEADLENMEGAAFAQTCLW
LGLAGAELRAVSNMAGVRDKAQWRIRQAVEALEHHILRIIGS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccctaccgttgctcctgctctctcccacgcgcctcgaggcccctttcctcaaa
ggccagaagttcgattttcacggacgcgcggggctgcgcggggcgggctgggtctggctg
gagtgcggcattggcaaggtcaacaccgccgccaccctggccgctttcgtccagcgacgc
aggttcgagcgggtgctgctctttggcattgcgggggcctatgccgattcgggcttgcag
ttaggcgattgcgccctggccgagcgggagattcaggccgacctgggcgtgcgggatggg
ggcctgaagggcctgggcttccccagcctggtggtggcctccaggccctaccacaaccgc
tttccgctggacaaagccttcacggacgaacttaagagcaaactgggcctgcctggcaaa
cagtttctgacccgcgacctggtctcggagaaccccaccgaggcccaccagctcgcgcgc
aaatgggaggccgacctcgagaacatggagggggccgcctttgcccagacctgtttgtgg
ctgggcctggccggggccgagctacgggcggtatcgaacatggccggtgtgcgcgacaag
gcccagtggcgcatccgacaggcggtggaggccctcgagcaccacattttgcgtatcatc
gggtcatga

DBGET integrated database retrieval system