KEGG   Meiothermus ruber DSM 1279: Mrub_0988Help
Entry
Mrub_0988         CDS       T01193                                 

Definition
(GenBank) ABC-2 type transporter
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane
Motif
Other DBs
NCBI-ProteinID: ADD27753
Position
979450..980202
Genome map
AA seq 250 aa AA seqDB search
MRRLVILFSAEAWRAWLEEVRYPLQFVMGLVFMGLIFFLLKGVAQLSGVSSSNPDTIFRL
LVGYLLGLLAISALGGIAAQVSREAKSGTLENMVLSGHGLTAFFVTQALARLAPILLNTV
ILFLVLTNHNKINFSLSWEMLPAIGLFYIAALGLGLVVGAVALLFKEIRTFFMLAQLLVF
PAVIANLPQLEWFPLVLGASVIRDLLQGSAVEAYWWILLLAETTAVFCIGVLLFELADRE
ARKRGLLGHE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtagactggttattttgtttagcgccgaggcctggcgcgcctggctggaagaggtg
cgttatccgctgcagtttgtgatgggcctggtttttatgggcctcattttcttcttgctg
aaaggcgtggcccagctctcgggggtatcaagctccaatccagacacgattttcagactt
ttggtgggttatctgctgggcctacttgcgatatctgctttaggtggcatagccgcgcaa
gttagcagagaagcaaagtccggtacgctggagaacatggtgctgtccgggcatggcctt
acagctttttttgtaacgcaggccctcgcccgcctcgcgccaattttgctcaacacggta
attttatttctggtactgaccaaccacaataagatcaactttagtctgagctgggaaatg
ctccctgccatcggattgttttacattgcggccctgggtctgggtctggtggtgggggcg
gttgcgttgctgttcaaggagatcagaacgttttttatgctggcgcagttattggttttt
ccggcagtcattgccaacctgccacagctcgagtggtttccgctggtgctgggtgcttcg
gtaattcgagacttactgcaaggcagcgccgttgaagcctactggtggatcctgcttctc
gccgagacaacggcggtgttctgcattggcgttctattatttgagcttgcagaccgagag
gccagaaagcggggccttcttggtcacgagtag

DBGET integrated database retrieval system