KEGG   Meiothermus ruber DSM 1279: Mrub_1004Help
Entry
Mrub_1004         CDS       T01193                                 

Definition
(GenBank) tRNA(Ile)-lysidine synthetase
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
mrb  Meiothermus ruber DSM 1279
Brite
Enzymes [BR:mrb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     Mrub_1004
Transfer RNA biogenesis [BR:mrb03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Mrub_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 MafB19-deam dCMP_cyt_deam_1 Bd3614-deam DUF2162
Motif
Other DBs
NCBI-ProteinID: ADD27769
UniProt: D3PQN6
Position
complement(996824..998389)
Genome map
AA seq 521 aa AA seqDB search
MELEEASQLEAQFATHLTRMVPEGSLVAAVSGGGDSVALLLLLTSTPRKVVVAHLDHSLR
PESGQDALWVKALAERLGYPFESEKLDVAKIAAERGGNLEATARELRYGFLAKVAKKHQA
QAILTAHTEDDQAETVLLQLLQGTGRGLGMRPKRGKVVRPLLELSRSTLRAYLRCKQQDW
LEDISNADTSLDRNFLRHEIFPRLKARFPQTQTALARFAAISQLDDEALDPLAEQLLLRD
RRWPCPAYRVAPLLQAPTGLRRRALRQILEHLRLRPEMGWVVQLERALHGEAFTLPEGWQ
VRRRDGTLFLIPPVIDTFPPWRGSRLPLPGDLIDLPKGLVRLVDFFTEHSLPPELKQNWP
VRAVGNVVREVWNLWPESEDLEHMRSALEQARLAQQAGEVPIGAVVVWDGEVLAEAHNQV
EQQCDATAHAELLALQQALHKRHSKVLPGATVYVTLEPCPMCFGALMEAQVRRVVYAVEN
LKAGAVTVHRMKPPFEWEGGWLERESAKLLRDFFSQKRVQP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtggagttggaggaggccagccagcttgaagcccagtttgctacgcacctgacccgcatg
gtgcccgaaggcagcctggttgctgccgtatcgggcgggggcgactcggtagcgcttttg
cttttgctcacctccaccccccgcaaggtggtggtggcccacctcgatcactcattgcgg
cctgagtcaggccaggacgcgctgtgggtcaaagccctggccgagcgcctgggctatcct
tttgaatcggaaaaactggacgtagccaaaatcgctgcggagcgcgggggcaacctcgag
gccaccgcccgcgagctgcgctacggctttctggctaaggtagccaaaaagcaccaggcc
caggccattctgaccgcccacaccgaggacgatcaggccgaaacggtgctgctgcagctt
ttacagggcaccggaaggggtctgggcatgcgccccaagcgggggaaggtggtgcggccc
ttgctcgagctcagccgcagcaccttacgggcttatctgaggtgcaagcagcaggactgg
ctcgaggacatctccaacgccgacacctcgctggatcggaacttccttcgccacgaaatt
ttcccccggctcaaagcgcgttttccccagacccagaccgctctggcccgcttcgccgcc
atctcccagctcgacgacgaagccctcgaccccctggccgaacagctcctgctgcgcgac
cggcgctggccctgcccggcctaccgcgtcgcaccactgctacaggcccccaccggcctg
cgccggcgggctttgcggcagatcctcgagcacctcaggctacgccccgagatgggctgg
gtggtgcagctcgagcgggccctgcacggcgaggcctttaccctgcccgaaggctggcag
gtgcgccggcgcgatggcaccctgtttctgattcccccggtgatcgacaccttccccccc
tggcggggctcgaggctccccctgcccggcgatctgatcgacctgcccaagggtctggtg
cggctggtggacttctttaccgaacacagcctcccacccgagcttaagcagaactggccg
gtgcgcgcagtgggcaacgtggtgcgtgaggtctggaacctctggcccgagtcggaggat
ctggagcacatgcgcagcgccctcgagcaggcccggctggcccagcaagcaggcgaagtg
cccatcggggccgtggtggtctgggatggtgaggtgctggccgaggcccacaaccaggtc
gagcagcagtgcgatgccaccgcccacgccgagctgctggccctccagcaggccctccac
aaacggcacagcaaggtgctgcccggcgctaccgtgtatgtaaccctcgagccctgccct
atgtgcttcggcgcgctgatggaagcccaggtgcggcgggtggtgtatgcggtggagaac
ctgaaggccggggcggtgacggtgcatcgcatgaaacccccctttgagtgggaagggggc
tggctcgagcgcgaatcggctaaactgctgcgggacttcttctcccagaagcgcgtgcag
ccctga

DBGET integrated database retrieval system