KEGG   Meiothermus ruber DSM 1279: Mrub_1015Help
Entry
Mrub_1015         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD27780
Position
1008774..1011071
Genome map
AA seq 765 aa AA seqDB search
MRTLIALFLAGILAACGRGPQEPTFIEPKISPQTRVLSLETRESLEGLVINNLNECLEYT
NQSRPRCQATLTFKAGSTQLGELEVGQILASEPGPNAPYGFLFKVKQITAGSEQVVVEAE
EAGLAEAITEGEASFQKNLGASDLVQAEGLSPGVRFANGQTRYQAQPGVQPMNVLDFAFN
EIIYDEDGNLSTTLDQVRAEGKVFFDLQNGFSASVTWKKALGIPVYPNGVYFKAAFGIKH
NTSVKIFSTLGKTIKKEYELAKYTFKPITVMVGPVPVVFVPNLYITISAEGTVSANLVLG
ASEELNAQACFEYKGGFRNCSSLSKKFEAGIAQANSTLKVTGSMNGKVDVLLYGLVGPYA
KLGAYLELSATVPGNPVWKLDAGVKGSIGIHADLWLFRLDTDLEIFNEKLGTIAQAQPGP
PSVVFGGGSLVNFEGGPFINRPYYICATAFDPQDGPLPVQISSSSDGSLGTAPTSSKCVS
YTFSTLGPRTLTARATNSLNLSTTATTTLTVQDIPPLAQIIQPLPSLNPTLPQAKAIPAG
RYLFLQAVWEDKSLSVPDCTRGEWRSRNRDTNADMGDEVPSLGCATRMRLSNQPGWRRIT
FKYTNPQGVAVEKFVLVNVGDPDPRGTNEPPLAKITRPLPTFSKDKAVNPTVGSTNLVLE
GTVFDADNTTLNYAWYLAEVVGGYPGPKKAVPGGSGSVNVPGDLNVTLPGVTIPSLAALF
PSVSTCPGYKQQFVAYLEVSDGVASSARPRPVIMAQRFELPVCIN
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacgttaatcgctttgtttctggcaggaattcttgcagcttgcgggagggggcct
caggagccgacattcatcgagcccaaaatttccccgcagacccgggtgctgagcctcgag
acccgcgagagcctcgagggcctggttatcaacaacctgaacgagtgcctcgagtacacc
aaccaaagccgtccgcggtgccaggccaccctgacctttaaagcgggtagcacacagttg
ggggagctcgaggtcggccagattctggccagcgagccgggccccaatgcgccctatggc
tttttgttcaaggttaagcaaatcactgcgggcagcgagcaggtggtggtggaggccgag
gaggccggtctggccgaggccatcaccgagggcgaggccagcttccagaagaacctgggg
gccagcgatctggtgcaggctgagggcctttctccgggggttcggttcgccaacggccag
acccgctaccaggcccagcccggcgtacagcccatgaatgtcctcgactttgccttcaac
gaaatcatctacgacgaagacggcaacctttccaccaccctggatcaggtgcgggccgag
ggcaaggtattttttgacttacaaaacggcttttcggccagtgttacctggaaaaaggcg
ctgggtattccggtttatccaaacggggtctacttcaaggcggcttttggcatcaagcac
aacaccagcgtaaagatcttctccaccctgggcaaaaccatcaagaaggagtacgagctt
gccaagtacaccttcaagcccatcactgtgatggtggggccggtgccggtggtgtttgtc
cccaacctctacatcaccatcagcgccgagggtacggtctcggccaacctggtgctgggg
gccagcgaggaactcaatgcgcaggcctgctttgagtacaaggggggctttaggaactgc
tcgagcctgagtaaaaagttcgaggccggcatcgcccaggccaacagcaccctgaaggtc
acgggctccatgaacggcaaggtggatgtgttgctgtacggcctggtggggccctatgcc
aaactgggggcgtacctcgagctgagcgccaccgtgcccggcaacccggtctggaagctg
gacgccggggtcaagggcagcatcggcattcacgccgacctctggctcttccgcctggat
accgacctcgagatcttcaacgaaaaactgggcaccatcgcccaggcccagccgggcccg
ccctcggtggtttttgggggtgggagtttggttaatttcgagggcggcccctttatcaac
cggccctattacatctgtgccacggctttcgatccgcaggatggtccactgccggtgcag
ataagctcgagttcggatggctccctgggcaccgcccccaccagcagtaagtgcgtgtcc
tacaccttctctaccctgggcccccgcaccctcacggccagggccaccaactccctgaac
ctgagcaccaccgccaccaccaccctgacggtgcaggacatccccccgctggcccagatc
atccagccgctgcccagcctcaaccccacgcttccacaggccaaggccatacccgcgggc
cgctacctgttcttgcaggccgtctgggaagataaatcgctgagcgtgcccgactgtacc
cgcggcgagtggcgaagccgcaaccgcgacaccaacgccgatatgggcgacgaagtgccc
agcctcggctgcgccacgcgcatgcgcctgagcaaccagcccggctggcggcgcattacc
ttcaaatacaccaacccccagggcgtggcggtggaaaagtttgtgctggtgaatgtggga
gatcccgatccgcgcggcaccaacgagccgccgctggctaaaatcacccgcccgctgccg
actttttccaaagacaaagcggtcaaccccaccgttggtagtaccaacctcgtgctggag
ggcacggttttcgacgccgataacacgaccctgaactacgcctggtaccttgccgaggtg
gtgggggggtatcccggccccaagaaagcagtgcctggcggttcgggtagcgtgaacgtt
cctggcgatctcaacgtgaccctgcccggtgttaccatccccagcctggccgcactcttc
ccctcggttagcacctgccctggttacaagcagcagttcgtggcctacctcgaggtctcg
gatggggttgcttccagcgctcggccgcggccagtcatcatggctcagcgcttcgagctt
ccggtgtgcataaactga

DBGET integrated database retrieval system