KEGG   Meiothermus ruber DSM 1279: Mrub_1028Help
Entry
Mrub_1028         CDS       T01193                                 

Definition
(GenBank) LmbE family protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ADD27792
Position
1024127..1025029
Genome map
AA seq 300 aa AA seqDB search
MLLTVLLVAAVVINAPSMVARGYGFYYRLTVNRLPQMTLAGERLLVLSPHPDDESLCCAG
AIQQVLKRGGEVWVLWFTSGDGFEWDAALLQDTLRPQGRASLELGQRRMGEARLAARRLG
VPPDHLIFLGYPDRGLRALLERHPQGTPYRSRLTLVSHVPYADALSPGAPYTGESLRRDF
RRVLERVQPTLVLAPSPRDAHADHRAVGLLAQQEVAAGRLRFWIVHGGLEWPLPKGLHPQ
LPLEPAPRGKGLPWQRLPLSPEERTAKLEALQAHASQMRLLARFMQAFVRQNELFSPRGE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgctgttgacagttttgctggtggcagcggtggtgatcaatgcgccgtccatggtggcc
cggggctatggtttttattatcgccttaccgtgaaccgcctgccccagatgaccctggcg
ggggagcggctgctggtgctttcgccccaccccgacgacgagagcctgtgctgtgcgggg
gccatccagcaggtgctgaagcgcgggggggaggtctgggtgctgtggtttaccagcggg
gacggcttcgagtgggacgccgcgctgctgcaggataccctcaggccgcaaggccgggcc
tccctcgagctggggcagcgtcgcatgggcgaggcccgcctggctgcccgccgtctgggg
gtgcccccggatcacctgatctttctgggctaccccgaccggggcctgcgggctctgctc
gagcgccatccccagggcacgccctatcgctcccgcctgaccctggttagccatgtgccc
tacgccgatgcgctctcgcccggcgccccctacaccggcgagtcgctgcggcgcgacttc
cgacgggtgctcgagcgggtgcagcccactctggtgctggccccttcccccagggatgcc
cacgccgatcaccgcgctgtgggtctgctggcccagcaggaggtcgctgccgggcggctg
cgcttctggattgtgcacggcgggctggaatggcccctgcccaagggcttgcacccgcag
ttgcccctcgagcccgccccgcggggcaagggcctgccctggcagcgcctgcccctgagc
cccgaggagcgtacggctaagctcgaggcgctgcaggcccacgccagccagatgcggctg
ctggcccgctttatgcaggcttttgtgcgccaaaacgagctctttagccctcgaggtgag
tag

DBGET integrated database retrieval system