KEGG   Meiothermus ruber DSM 1279: Mrub_1031Help
Entry
Mrub_1031         CDS       T01193                                 

Definition
(GenBank) polysaccharide deacetylase
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1 DUF2334
Motif
Other DBs
NCBI-ProteinID: ADD27795
Position
1027434..1028726
Genome map
AA seq 430 aa AA seqDB search
MKSWKGPQLFQTPFICWAMLEGMRPWVCLLPWALGLVLAQPSSPTPLPPVQAIPPGEMQP
LAPGQRPAPTLPQIVLNPPIRFVERIAWASNGFVEAAEALVLIPEASTTPSFMLTKAQRV
VAETFAARPSLSYVDVSIYSRREYAGFGGPLPRFTASVSRARLNEFLRLNLSNFLQFDHL
WIKPQDAFYGPPAPVTDELELTPQFQGTRAQLRAQQLEQTVASQQGGVVGNRLFHGDPRQ
RVVALTFDDAPHPLFEPLLLDTLRRAGVRATFFCIGRNAEAYPYFVRDMVQQGHEVANHT
YHHVRLNGLDEASVTAEIVQANQVLQAITGKPIVYFRPPGGRFSPTVLEVMRRLNMTVVF
WTDDPGDFDNIGQGPLEARLLRRLRPGGIVLLHDNVLQTIAVLPRFLALAGQQGYRLGTV
GGLVQGVDRR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagagctggaaggggcctcaattgtttcagacccccttcatctgctgggcgatgcta
gagggtatgaggccttgggtatgcttactgccgtgggcgttggggctggtgctggcccag
ccgagcagcccgacgccgcttcccccggtgcaggccattccgcccggcgagatgcagccg
ctggcacccggtcagcggccagcgcccacactaccccagatcgttctcaacccgcccatc
cgcttcgtggagcggatcgcctgggcctccaacggttttgtggaagcggccgaggccctg
gtgctgattccggaggcctccaccacccctagctttatgctcaccaaggcccagcgggtg
gtggccgagacctttgcggcccggccctccctgagctatgtggatgtctcgatttatagc
cggagggagtacgcgggctttggaggccccttgccccgttttaccgcttcggtctcgcgg
gccaggctcaacgagtttttgcgcctgaacctgagcaactttttgcagtttgaccacctc
tggatcaagccgcaggacgctttttatggcccacccgcgcccgtaaccgacgagctcgag
ctcaccccccagttccagggcacccgggcccagctccgcgcccagcagctcgagcagacc
gtggccagccagcagggcggggtggtgggcaaccgcctttttcacggcgaccccaggcag
cgcgtggtggccctgaccttcgacgatgcgccccaccccctgttcgagccgctgctcctc
gacaccctgcgccgggcgggtgtgcgggccaccttcttctgcattggccgcaacgccgag
gcctacccctacttcgtacgggatatggtgcagcaagggcacgaggtcgccaaccacacc
taccaccatgtccgcctcaacggcctcgacgaggccagtgtgaccgccgagatcgtccag
gccaaccaggtgcttcaggccatcaccggcaagcccatcgtctactttcgcccgcccggg
ggtcgcttctcacccacggtgctcgaggtgatgcgacggctaaacatgacggtggtcttc
tggacggacgatccaggcgacttcgacaacatcgggcagggccccctcgaggcccggttg
ctgcggcggctgcgccccggtggtatcgtgctgttgcacgacaacgtgctccagaccatc
gcggtgctgccgcgctttctggctttggcaggacagcagggctaccggctgggcacggtg
ggtgggctggtgcagggggtggatcggaggtag

DBGET integrated database retrieval system