KEGG   Meiothermus ruber DSM 1279: Mrub_1039Help
Entry
Mrub_1039         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD27803
UniProt: D3PQS0
Position
1034978..1035466
Genome map
AA seq 162 aa AA seqDB search
MRLIELAVVLALAGFLALAASALLFYGSEASREARLRLGAEIAYDELRARLGRDMREALQ
ISSLVASELRLVVAGGCVVYRLQSGQLFRQAWVGGCAVVSGVPVRLLEDTSLPLARFCSD
PALRRMGLFDVCPSNWNSVGGGLTLRQNNQDQVFAPPVVSLR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgattgaactggcagtggtactggctctagccggatttttggctctggcagct
agtgctctgctgttttatggcagcgaggcttctagagaggcccgtttgcgcttgggcgcc
gagatagcctacgatgaactccgggctcggctgggacgcgatatgcgtgaggcgttgcag
attagtagccttgtggccagtgaattacgtcttgtcgtggctggaggatgtgttgtgtac
cggctccagagcggccagctttttcgtcaggcctgggtgggtggctgtgcggttgtatcg
ggggtgccggtgcgccttctggaagataccagcctccctttggcgcgtttctgtagtgac
cctgcattgcgccggatgggtctgtttgatgtttgcccctcgaactggaactctgttggg
ggagggctgaccctgcgccagaataatcaagatcaggtttttgcgcctccggtggtctcg
cttcgttga

DBGET integrated database retrieval system