KEGG   Meiothermus ruber DSM 1279: Mrub_1047Help
Entry
Mrub_1047         CDS       T01193                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mrub_1047
Enzymes [BR:mrb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mrub_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1042159..1043106
Genome map
AA seq 315 aa AA seqDB search
MRYQPADSLESPRFAGVRTFMRLPHVRTLENVDFVVLGIPWDDATTHRPGARFGPEGIRR
VSIMLRPWNPYWDVKIFDYLSGVDYGDVPVVPGYIEDTYARIEAEFERIARAGVTPIAMG
GDHSVTLGELRGLAKVHGPLALVHIDAHLDTLDQYFGRKYNHGTPFRRAVEEGLVDPHRS
IQVGIRGSNYGPEDYQGTRDLGYELITMYELQEIGLEATLERIHRRVGPAPCFISIDIDA
VDPAYAPGTGTPEVDGFTSREILRLVRGLKGLNFKAADVVEVLPALDPGEITAYLGGNLI
YELISLLALRKKEGR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgagataccaacccgccgactccctcgagtccccccgctttgctggggtgcgcaccttc
atgcgcctgccccatgtccgtaccctggagaacgttgactttgtggtgctgggcatcccc
tgggacgatgccaccacccaccggcccggggcccgctttggccccgagggcatccgccgg
gtctcgatcatgctcaggccctggaacccctactgggatgtgaagatattcgactacctt
tccggggtggactacggcgacgtgccggtggtaccgggctacatcgaggacacctacgcc
cgcatcgaggcggagttcgagaggattgcccgggccggggtcacgcccatcgccatgggg
ggggatcactccgtcaccctgggtgagctgcgtggcctggccaaggtgcacggcccgctg
gccctggtgcacatcgacgcgcacctggacaccctggaccagtactttgggcgcaagtac
aaccacggtacccccttccgccgcgcggtggaggagggcctggtggatccgcaccgttcc
attcaggtgggcatccgcggctccaattacggccccgaggattaccagggcacccgcgac
ctgggctacgaactcatcaccatgtacgagctgcaggagatcggccttgaggccaccctc
gagcgcatccaccgccgggtgggcccggccccctgctttatcagcatcgacatcgacgcg
gtggatccggcctacgcccccggcaccggcacccccgaggtggacggcttcaccagccgg
gagatcctgagattggtgcggggccttaagggtctgaacttcaaggccgccgatgtggtc
gaggtgctacccgccctcgaccccggggagatcaccgcctacctggggggcaacctaatc
tacgaactcatctcgctgctggccttgcgcaagaaggagggccgatga

DBGET integrated database retrieval system