KEGG   Meiothermus ruber DSM 1279: Mrub_1050Help
Entry
Mrub_1050         CDS       T01193                                 

Definition
(GenBank) metal dependent phosphohydrolase
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GAF_2 GAF GAF_3 HD HD_5
Motif
Other DBs
NCBI-ProteinID: ADD27814
UniProt: D3PQT1
Position
1045190..1049131
Genome map
AA seq 1313 aa AA seqDB search
MSSGILERLLGALGQALRPGGDPQSLARRGLSALVQTLDACGAWLRLRENGLSLLAAVGV
EPPEEAHLTPQEAEALAAGHVLVYRLPEEATGPASAGWGALGYQGLILAPLHGGGELLGT
LALLFAERPPPVARALEEVLPLFGLLLERARAEEELVRRQRLLEALHQLDRAMLEEKSLL
EVARIGAEAAQGLLKAQAVAVSLVEKEGHRLVAAVGGALEPLVGQLAPLGEGFYHQAWRS
GEPALLPEIPGQGMSGWLLALAPFKNALILPLKPDGTTLGFVGLYGLGDPDAARPLAQSF
AAQLSLALLHEQNREALFQRAREQEVLLRALEALGEAANPEEAARRLGALALELLPSEWA
AVLLLEQGVLRVAAASGAMAGSLGLRIPPDQGLSWAALRQGTQVVADTTKDPRVYTPPEF
PTPLVGSEVVTPLPGSHGEALGVLIVFRSTLPYTPQEARLVEALAQAGATALQRAQHNLE
ARLMLEGALLVAQEPAPESLIQGFAQLMAQVVGGGRAAIWAHPEGRRPWRLLGVAGVGAE
AASFFEARLDPEAGGWTGWIYRQQRPLVIEDVASPPVEPAPVEASGLRLYGVQSVLGVAV
GNFGVAYAEPGSRGKFFASFEVTLLERLAGMLAGGLERHRLAVAEQRVRRALERLAQVPP
GDLEALVRALGESLGVRWAFIDRLITPERALAVAVYGGASFEYDLPGTPCADVFAGNFCE
YPRGVTACFPEDRLAAEMGAEAYLGVPLRGEGGRVLGILVAMHDAPLPEDERDLRREIVL
AYAQRAALELGQQENRARLEATARVHSLLRPAQNSQEVIQIAVEAVLRETRATTALLSLY
RENGDYLEVVAAAGYLAEVARGRRMERGMGLSWRVFEEEKPLYFEDASQTSQAIFFSGKP
SRAAYLGVPLRDAQGRILGVLSADTAEQGGVLFPEDRHFLVALAEATGAAMARLDALHQA
QMEARRFRVLAELSARLEGLEAPKEILEEALEALYRISGFQVACFHEVAPEGLRLLMVAG
EPSEDWLQRAWHETYPPGHGLRGRVLLTGEALYVPHYPDHPLALAASVAMGLKCAAYAPV
RFSERTVGVLSLLDFRTAYLEDPLPLLNFAARRLANALEKAENLQQLRTTREEALKALGL
ALEYRDLETAGHTERVTRLALELAEGMGLSEPTLTHLRWGAYLHDLGKLAIPDGILKKPE
KLTLEEWEQMKAHTVLGEEMARRMGFLPPATLAVIRHHHERWDGSGYPDGLAGEAIPLLA
RIFALADVYDALTSQRPYKRAWRPEEALAEIAAQAGRHFDPTLCRIFLQRVGG
NT seq 3942 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcgggcatactcgaaagactgctaggggcgctgggccaggccctgaggccgggg
ggagacccccagtccctggcccggcggggcctcagcgccctggttcagaccctggatgcc
tgcggggcctggttgcggctgcgtgaaaacgggctgagcctgctggctgcggtgggggtc
gagccgccggaggaggcccatctaaccccacaagaagccgaggccctggccgctggccat
gtgctggtctaccgcctgcccgaggaggccaccggcccagccagcgcaggctggggggcg
ctggggtaccaggggttgatactggctccgctgcatggcggtggggagttgcttgggacg
ctggccctgctctttgccgagaggccacccccggtggcccgggccctcgaggaggtactg
cccctgtttggactgctgctcgagcgggcccgcgcagaggaggaactcgtccgccggcag
cggctgcttgaggccctgcaccaactggatcgggctatgctggaggaaaaaagcctgctc
gaggtggcccggattggggccgaggcggcccaggggctcctcaaggcgcaggcggtagcg
gtttctctggtggaaaaggaaggacaccgcctggtggcggcggtggggggggcgctcgag
cccctggtgggccagcttgcgcccctgggggaggggttctaccaccaggcctggcgcagc
ggagagccagccctgctgcctgaaattcccggtcaggggatgtccggctggcttttggcg
ctggctccgttcaagaatgccctcatactgcctctgaagcccgatggcaccacactgggg
tttgtggggctgtacggcctgggcgatcccgatgcggccaggcccctggcgcagtccttt
gcggcgcagctatcgctggccttgctgcacgagcaaaaccgcgaggccctgttccagcgg
gctcgagagcaggaggtgctgctgcgggcgctcgaggccctgggtgaggccgccaacccc
gaagaggccgcccggcgcctgggggcgcttgccctggagctgctgccttcggagtgggcc
gcggtgctgctcctggaacagggtgtgctgcgggtggcggccgccagcggggccatggct
gggtcgcttggcctgcgaatcccgcccgatcaggggctctcctgggcggctcttcgccag
ggcacccaggtggtagcggacacaacgaaagatccccgggtctacacccccccggagttt
ccgacccctcttgtcggcagcgaggtcgtcacccccctgccgggatcccatggggaggcc
ctgggcgtgctgatagttttccgctcaacccttccctacaccccgcaggaggcccggctg
gtggaggcgctggcccaggccggcgccaccgcgttgcagcgcgcacagcacaacctggaa
gcccgcctgatgctggaaggggccttgctggttgcacaagaaccggcccctgagagccta
atccagggcttcgcccagcttatggcacaggtggtggggggtggccgggcggccatctgg
gcccacccggaggggcggcggccctggcggttgctgggggtggccggggtgggcgccgaa
gcggcctccttttttgaagcccgccttgacccggaggctgggggctggacaggctggatc
taccggcaacagaggcccctggtgatagaggatgtggcctcgccgccagtggagcccgcc
ccggtggaggcttcgggcctcaggctatatggcgtgcagagcgttctgggtgtagcggtg
ggcaattttggggtggcctacgccgagccgggcagccggggtaagttttttgcaagcttc
gaagtaacgctgctcgagcgcctggccgggatgctggcggggggactggagcggcaccgg
ctggctgtggccgagcagcgggtgcgccgggcgctggagcggctggcccaggtgcccccg
ggcgacctcgaggcgctggtgcgggccctgggggagagcctgggggtgcgctgggctttt
atcgaccgactgatcacgcccgagcgggccctggcggtagcggtctatggcggggcctcc
tttgagtacgacctgccaggcaccccatgcgccgatgtttttgctggcaatttctgtgag
tacccgcggggggtcacggcctgttttccggaggatcggctggctgccgaaatgggggcg
gaggcctaccttggggttcctctgcgcggtgagggcgggcgggtgctgggcatcctggtg
gccatgcacgacgccccgctacccgaggacgaacgcgacctgcgacgggaaattgtactg
gcctacgcccagcgggctgcgctggagctggggcaacaggagaaccgcgcccgcctcgag
gccaccgcccgggtgcacagcctgctgcgcccggcccagaacagccaggaggtgattcag
atcgctgtggaggccgtgctgcgggagacccgggccaccaccgccctgctctcgctgtac
cgtgagaacggggactatctggaagtggtggcggcggcgggctacctggccgaggtcgcg
cggggacggcggatggaacggggaatgggcttgtcctggcgggtgtttgaagaggagaag
cccctttacttcgaggacgcctcgcaaacatcccaggccattttcttttctggaaagccc
agccgggcggcctacctgggggttccgctgcgcgatgcgcaggggcgaattctgggggtg
ctatccgccgataccgctgagcaaggcggcgtgttgttccccgaggatcgccactttctg
gtggccctggccgaggccaccggggcggccatggcccgcctggacgcgctgcaccaggcc
cagatggaggcccgacgcttccgggttctggccgagctctcggcccggctggagggattg
gaggcccccaaagagatcctggaggaggccctggaagccctgtaccgcatcagcggcttc
caggtggcctgttttcatgaggttgccccggaaggcctgcggcttttgatggtggctgga
gagccctcggaggactggctccagcgggcctggcatgagacatacccccccggccacgga
ctgcggggccgggtgctgctaaccggggaagccctgtacgttccgcactatccggatcac
cccctggccctggctgcttcggtggcgatggggctcaagtgcgctgcttatgcaccggtg
cgtttttccgagcggacggtgggggtgttgagcctgctggatttccgtacggcctacctc
gaggatccgctgcccttgctcaatttcgcggcccgccggctggccaacgccctggagaaa
gcggaaaacctgcaacagctccgcaccacccgtgaagaggcccttaaggccctgggtctg
gcgctggagtaccgcgacctcgagaccgccgggcacaccgagcgggtaacgcggctggcc
ctggagctggccgaggggatgggcctgagcgagccaaccctcacgcatctgcgctggggg
gcctatctgcacgacctgggtaagctcgctatccccgatggcatcctgaagaagccggaa
aaactgacgcttgaggagtgggagcagatgaaggcccacaccgttctgggtgaggagatg
gcccggcgcatgggcttcctacccccggccaccctagcggttattcgccatcaccacgag
cgctgggacggctcgggctaccccgacgggctggccggggaggccatccccttgctggcc
cgcatctttgccctggccgacgtgtacgacgcgctcacctcccagcggccctacaaacgg
gcctggcgccccgaagaggccctggccgagatcgcagcccaggctgggcggcacttcgac
ccaacgctgtgccggatcttcctccagcgggtggggggctaa

DBGET integrated database retrieval system