KEGG   Meiothermus ruber DSM 1279: Mrub_1071Help
Entry
Mrub_1071         CDS       T01193                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE HTH_23 Sigma70_r4_2 HTH_29 HTH_28 HTH_38 HTH_40 Sigma70_r4 HTH_7 Sigma70_ECF HTH_24 HTH_20 Terminase_5 HTH_5 HTH_AsnC-type HTH_IclR HTH_11 HTH_10 DUF2089
Motif
Other DBs
NCBI-ProteinID: ADD27835
UniProt: D3PQV2
Position
1074496..1075125
Genome map
AA seq 209 aa AA seqDB search
MIRILLVDDHPVVRAGLLGLLSSQPDFEVVGEASNGLEALGLLERAGADVVLMDLRMPQM
DGVAAIRQVRARFPRVQILVLTTYDTDSKIVRAVEAGATGYLLKDVPREELFRAVRLCAK
GEAVLSPPVAARLLGRMRGTAEETLSVRELEVLALVAKGFSNKEIARELKISEATVKTHL
LHTFEKLGVDDRTAAVTVAIERGILRLEG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgattcggattcttctggttgacgaccatcccgtggtgcgggcgggtcttttagggctg
ctctcctcgcagcccgactttgaggtggtcggtgaggcctccaacggcctcgaggccctg
ggcctgctcgagcgagctggggccgatgtggtgctgatggatctgcgcatgccccagatg
gacggggtagcggccatacggcaggtgcgggcgcgttttcccagggttcagattctggta
ctcaccacctacgacaccgactccaaaattgtgcgcgcggtggaggccggggctaccggc
tacctgctcaaagacgtgccgcgcgaagagctcttccgggccgtgcggttgtgcgcaaag
ggtgaggcagtactctcacccccggtagcagcccgcttactgggccggatgcgcggcact
gccgaggaaaccctatcggtgcgcgagctcgaggtgctggctttggtagccaaaggtttt
tccaacaaggagatcgcccgcgagctcaagatcagcgaagcaaccgtcaaaacccacctc
ctgcacacttttgaaaaactgggtgtggacgaccgcacggccgcggtcacggtggccata
gaaaggggtattctccggcttgaaggctaa

DBGET integrated database retrieval system