KEGG   Meiothermus ruber DSM 1279: Mrub_1072Help
Entry
Mrub_1072         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD27836
UniProt: D3PQV3
Position
1075148..1075534
Genome map
AA seq 128 aa AA seqDB search
MKLLRYLVPVGIGLLIALADLGNVDLLFAGTLLLLMGFVVGWWWPQQWWLSGLLMGGILP
LVQLWASVVQFPMPYVPDPLQGLLLLVPALLMAGFGAIVHNKTPYTPAALRARLRRAQQA
DHHDHEQP
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcctgcgctaccttgtaccggtgggcattggactcctgatcgctttggccgac
ctcggcaacgtggatctgctctttgctggaaccctgctgctcttgatggggtttgtggtg
gggtggtggtggccccagcaatggtggctgagtgggcttttgatggggggaattctgcct
ttggtacagctatgggcctcggtggtgcagtttcccatgccctatgtgcccgacccgctg
cagggcctgttgttgctggttcccgctctgctgatggcggggtttggggccatcgtacac
aacaaaacgccctacacccccgccgcgctgcgcgcccgtttgcgccgggcccagcaggcc
gaccaccacgaccacgagcagccctga

DBGET integrated database retrieval system