KEGG   Meiothermus ruber DSM 1279: Mrub_1077Help
Entry
Mrub_1077         CDS       T01193                                 

Definition
(GenBank) zinc finger SWIM domain protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SWIM
Motif
Other DBs
NCBI-ProteinID: ADD27841
UniProt: D3PQV8
Position
1081830..1082258
Genome map
AA seq 142 aa AA seqDB search
MRLELESLLELADEGVHTRGEALFLRGAVLEAARSRGRLQARVQGSAPFPYRVEINLSQG
GWACTCPYAWGPVCKHVVAVALAALEAPEIFTRKKLGRRAPVNLQAILELSDDELLRFLW
QLAEVRPELMHEFAYNLMQRFE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgcggctggaactggaaagcctgctcgagctggccgatgagggggtgcacacacggggc
gaggcgctttttttgcggggggcggtgctcgaggccgcccggagccggggccgcctgcag
gcgcgggtacaggggagcgcccctttcccttaccgggtcgagattaatctgagccagggc
gggtgggcctgtacctgcccttatgcctgggggccggtgtgcaagcacgtggtggcggtg
gcgttggccgccctggaagctcccgagatcttcaccaggaaaaagctgggccggcgcgca
cccgtgaacttgcaggcgatactcgagctgtccgacgacgaactgctgcgcttcttgtgg
caactggccgaggtgcgccccgagcttatgcacgagtttgcctacaacctaatgcagcgc
tttgagtga

DBGET integrated database retrieval system