KEGG   Meiothermus ruber DSM 1279: Mrub_1080Help
Entry
Mrub_1080         CDS       T01193                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mrb01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mrb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1084523..1085656)
Genome map
AA seq 377 aa AA seqDB search
MHGRLPLTAQTHRRLVVKVGSAVLSGPQGRQHQLAIAAQVAALRAEGREVVLVSSGAQAT
GMQKLGLTEKPKSMPGKQALAAVGQPTLMLLWEQAFSWYDLKVAQVLLTAEDLAHRHRYL
NARQTLETLLEWGIVPIINENDTVMVEEIKFGDNDQLSALIASLVGADLLILLSDIEALY
EADPRTHPEAQPIPYVERVDAGVLRMAGDSPNRVGTGGMKSKLLAAEKAQAAGIPTLLLP
GTRPQSIAEALQGAPVGTLFAGGQRRYSGRKLWLYQLPKPQGEVVVDAGAAKALRQGGAS
LLPAGILEVRGQFGVGEAVRCLDEQGNLIGVGLVNYSAAELARIKRRKTREIEALLGYKN
TDEAIHRDYFALASELE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcacggtcgtcttcccctcaccgcccaaacccatcgccggctggtagtcaaggtgggc
agcgccgtcctgagcgggccccaggggcggcagcaccaactggccattgccgcccaggtg
gccgccctgcgggccgaggggcgcgaggtggtgctggtctcctcgggggcccaggccacc
ggcatgcaaaagctgggcctgaccgaaaagcccaagtccatgcccggcaaacaggccctg
gccgccgtcgggcagcccaccctcatgctcctgtgggagcaggcttttagctggtacgac
ctgaaggtggcccaggtgttgctcaccgccgaagatctggcccaccgccaccgctacctg
aacgcccggcagaccctggagacgcttttggagtggggcatcgtgcccatcatcaacgag
aacgacacggtaatggtggaggagatcaagtttggcgacaacgaccagctttcggccctg
attgcttcgctggtaggggccgatctgctgatcttgctctccgacatcgaggctttgtac
gaggccgacccccgcacccaccccgaagcccagcccatcccctacgtggagcgggtggat
gccggggtgctgcgcatggcaggcgacagtcccaaccgggtgggcaccggcgggatgaaa
agcaagctgctggccgcggaaaaagcccaggccgccgggattcccaccctgctgctgccc
ggcacccggccccagagcatcgccgaggccctgcaaggcgccccggtgggcacgctgttt
gccggggggcagcgccgctacagcggccgtaagctctggctgtaccagctccccaagccc
cagggggaggtggtggtggacgccggggcggcgaaagccttacgccagggcggggcctcg
ctcctgccggcgggcatcctcgaggtgcgcgggcagtttggggtgggcgaggcggtcagg
tgcctggacgagcagggcaacctgatcggggtgggcctggtcaactacagcgccgccgag
ctcgcccgcatcaagcgccgaaaaaccagggagatcgaggccctgctgggctacaaaaac
accgacgaggccatccaccgcgactactttgccctggcctcggagctcgagtga

DBGET integrated database retrieval system