KEGG   Meiothermus ruber DSM 1279: Mrub_1080Help
Entry
Mrub_1080         CDS       T01193                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00330  Arginine and proline metabolism
mrb00332  Carbapenem biosynthesis
mrb01100  Metabolic pathways
mrb01130  Biosynthesis of antibiotics
mrb01230  Biosynthesis of amino acids
Module
mrb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mrub_1080
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Mrub_1080
Enzymes [BR:mrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mrub_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA TruB-C_2
Motif
Other DBs
NCBI-ProteinID: ADD27844
UniProt: D3PQW1
Position
complement(1084523..1085656)
Genome map
AA seq 377 aa AA seqDB search
MHGRLPLTAQTHRRLVVKVGSAVLSGPQGRQHQLAIAAQVAALRAEGREVVLVSSGAQAT
GMQKLGLTEKPKSMPGKQALAAVGQPTLMLLWEQAFSWYDLKVAQVLLTAEDLAHRHRYL
NARQTLETLLEWGIVPIINENDTVMVEEIKFGDNDQLSALIASLVGADLLILLSDIEALY
EADPRTHPEAQPIPYVERVDAGVLRMAGDSPNRVGTGGMKSKLLAAEKAQAAGIPTLLLP
GTRPQSIAEALQGAPVGTLFAGGQRRYSGRKLWLYQLPKPQGEVVVDAGAAKALRQGGAS
LLPAGILEVRGQFGVGEAVRCLDEQGNLIGVGLVNYSAAELARIKRRKTREIEALLGYKN
TDEAIHRDYFALASELE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcacggtcgtcttcccctcaccgcccaaacccatcgccggctggtagtcaaggtgggc
agcgccgtcctgagcgggccccaggggcggcagcaccaactggccattgccgcccaggtg
gccgccctgcgggccgaggggcgcgaggtggtgctggtctcctcgggggcccaggccacc
ggcatgcaaaagctgggcctgaccgaaaagcccaagtccatgcccggcaaacaggccctg
gccgccgtcgggcagcccaccctcatgctcctgtgggagcaggcttttagctggtacgac
ctgaaggtggcccaggtgttgctcaccgccgaagatctggcccaccgccaccgctacctg
aacgcccggcagaccctggagacgcttttggagtggggcatcgtgcccatcatcaacgag
aacgacacggtaatggtggaggagatcaagtttggcgacaacgaccagctttcggccctg
attgcttcgctggtaggggccgatctgctgatcttgctctccgacatcgaggctttgtac
gaggccgacccccgcacccaccccgaagcccagcccatcccctacgtggagcgggtggat
gccggggtgctgcgcatggcaggcgacagtcccaaccgggtgggcaccggcgggatgaaa
agcaagctgctggccgcggaaaaagcccaggccgccgggattcccaccctgctgctgccc
ggcacccggccccagagcatcgccgaggccctgcaaggcgccccggtgggcacgctgttt
gccggggggcagcgccgctacagcggccgtaagctctggctgtaccagctccccaagccc
cagggggaggtggtggtggacgccggggcggcgaaagccttacgccagggcggggcctcg
ctcctgccggcgggcatcctcgaggtgcgcgggcagtttggggtgggcgaggcggtcagg
tgcctggacgagcagggcaacctgatcggggtgggcctggtcaactacagcgccgccgag
ctcgcccgcatcaagcgccgaaaaaccagggagatcgaggccctgctgggctacaaaaac
accgacgaggccatccaccgcgactactttgccctggcctcggagctcgagtga

DBGET integrated database retrieval system