KEGG   Meiothermus ruber DSM 1279: Mrub_1082Help
Entry
Mrub_1082         CDS       T01193                                 

Definition
(GenBank) beta-galactosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00460  Cyanoamino acid metabolism
mrb00500  Starch and sucrose metabolism
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mrub_1082
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Mrub_1082
Enzymes [BR:mrb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Mrub_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ADD27846
UniProt: D3PQW3
Position
complement(1088147..1089490)
Genome map
AA seq 447 aa AA seqDB search
MTTFSKSDFGPGFLWGVATAAYQIEGAVNEDGRSPSIWDTFSHTPGKIKTGENGDVACDF
YHRYHDDIAFIREMNMQVHRFSLAWPRILPGGTGPVNQKGLDFYHRVIDRTLELGLQPWV
TLYHWDLPQVLEDRGGWTNRDIVGWFSEYVEVCSKAFGDKVKHWMVLNEPTVFTVLGYLQ
GTHAPGRKGFGNFLPAVHHVALAQAEGGRVLRAHVPDAQIGTTFSASYVQPAGPTWLSRM
AAANYDVIANRLFLEPALGLGYPWKTTPFLLALQRYIRPGDMERLAFDFDFIGLQTYFRQ
LVRFDLLNPGTWGREVPHAERGSKELTEMGWEVWPENIYHLLKKFAAYSGVKRIIVTENG
AAFPDKLEGEQVHDPQRIQFIQDHLAQVLRAKQEGVPVEGYFYWSLLDNFEWAEGYRPRF
GLVYVDYPTQKRVLKDSGKWFREFLAN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctttagcaaaagcgactttggccctggcttcctgtggggggtggccaccgca
gcttatcagatcgagggcgcggtgaacgaggacgggcgcagcccttccatctgggacacc
ttctcccatacccccggcaagatcaaaaccggcgagaacggcgatgtagcctgcgacttc
taccaccgctaccacgacgacatcgcctttatccgggagatgaacatgcaggtgcaccgc
ttttcgctggcctggccgcgcatcctgcccggtggaaccggcccggtcaaccagaagggg
ctggacttctaccatcgggtgatcgaccggacgctcgagctgggcctgcagccctgggtg
accctgtaccactgggatctgccgcaagtgctggaagacaggggcggctggaccaaccgc
gacattgtgggctggtttagcgagtacgtggaggtgtgcagcaaggcctttggcgacaag
gtcaagcactggatggtgctcaacgagcccacggtgttcaccgtgctgggctacctgcaa
ggcacccacgccccgggccgcaaaggttttggcaactttttgccggccgtccaccacgtg
gctttagcccaggccgaaggggggcgggttctgcgggcgcatgtgccggatgcccagatc
ggcaccaccttctcggcctcctatgtgcagccggcgggccccacctggctgagccgcatg
gccgccgccaactacgacgtgatcgccaaccggctgttcctcgagcccgccctggggctg
ggctatccctggaaaaccaccccctttttgctggccctgcagcgctacatccgtccgggc
gatatggagcggctggccttcgatttcgactttatcggcttgcagacctacttccgccaa
ctggtgcgcttcgacctgctgaaccccggcacctggggccgggaagtgccccacgccgag
cggggcagcaaggagcttaccgagatgggctgggaggtctggccggaaaacatctatcac
ctactcaagaaatttgcagcctatagcggggtgaaacgcatcatcgttacagagaacgga
gcggccttccccgacaaactcgagggcgagcaggtgcacgacccccagcgcatccagttc
atccaggatcacctggcccaggtcttgcgggccaaacaggagggggtaccggtggagggg
tatttctactggagcctgctggacaacttcgagtgggccgaggggtaccggccccgcttt
gggctggtatacgtggactaccccacccagaagcgcgttctgaaggactccggcaagtgg
ttccgggagtttctagccaactga

DBGET integrated database retrieval system