KEGG   Meiothermus ruber DSM 1279: Mrub_1121Help
Entry
Mrub_1121         CDS       T01193                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mrub_1121
Enzymes [BR:mrb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mrub_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1128015..1129520
Genome map
AA seq 501 aa AA seqDB search
MQLQRAFGILLHPTSFPGRWGIGALGREAERFLDWLADAGARWWQVLPLGPTSYGDSPYQ
SFSAFAGNPYLVDPEMLIEKGWLEQSEAPPPYPTQRVDYGWLYQTRWPLLRRAFAGFRAR
ASAQDKTRLEAFIEAERFWLEDYALFMALKTRFDGKPWNEWSPELRDREPAALARAREEL
AEEVALYEWIQWLFYLEWGQTKAYAESKGIQIIGDMPIFVAFDSSDVWANPQYFYLEADG
NPTVVAGVPPDYFSETGQLWGNPLYRWDVMERDNFAWWIARIRQSLKQCHLVRIDHFRGF
EAYWEVPFGRPNAVEGRWVKAPGEKLFAAVRAQLSDAPIIAEDLGVITPEVEALRDGFGF
PGMKILQFAFSGEDNAFLPHNYPAHGNVVVYSGTHDNDTTLGWFRTAPEAERAFMRAYLA
RYGIRCLSEYEVAGALIELAFKSPAKLAIVPLQDVLGLGPEARMNFPGRLGDNWAWRYAE
GDLEPGLAAGLRALAEASQRA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcaactccaacgcgcttttggaattttgctccaccccaccagttttccgggtcgctgg
gggattggggctctgggccgcgaggccgagcggtttttggactggctggccgatgcggga
gcccgctggtggcaggtcttaccgctgggccctaccagttacggcgactcgccgtaccag
tccttctcggcttttgccggtaacccgtatttggttgaccccgagatgctgattgaaaaa
ggctggctggaacaaagcgaagcgcccccgccgtatccgacccagcgcgtggattatggc
tggctttaccagacccgctggcccctgttgcggcgggctttcgcggggtttcgggcaagg
gcttcggcccaggataagacccgactggaagcctttatcgaggccgagcgcttctggctg
gaagactatgcgctctttatggccctcaagacccggtttgacggcaagccctggaacgag
tggagccccgagctgcgcgaccgtgaaccggctgccctggccagggcccgtgaggagctg
gccgaggaggtggccctttacgagtggattcagtggcttttttatctggaatggggccag
accaaggcctatgccgaatccaaggggattcagattatcggcgatatgcccatctttgtg
gccttcgattcctcagatgtctgggccaacccgcagtacttctacctcgaggccgatggc
aaccccacggtggtggcgggcgttccgccggactacttctccgaaaccggccagctctgg
ggcaatccgctctatcgctgggatgtgatggaaagggacaactttgcctggtggattgcc
cgcataaggcagtcgctcaagcagtgccacctggtgcgcatcgaccacttccgcgggttt
gaagcctactgggaggttccgtttggccggcccaatgctgtggaggggcgctgggtcaaa
gccccaggggagaagctgtttgctgcggtgcgggcccaactgagcgatgcgcccatcatt
gccgaagacctgggggtgatcacccccgaggtggaggctttgcgcgatggcttcgggttc
cccggcatgaagattttgcagtttgctttttccggtgaggacaacgcctttttgccccac
aactaccccgcgcacggcaatgtggtggtgtacagcggaacccacgacaacgacaccacc
ctgggatggttccgcaccgcgccggaggccgagcgggccttcatgcgggcctacctggcc
cgctatggcatccgttgtttgtcggaatacgaggtcgcgggcgctttgatcgagctggcc
ttcaaaagcccggccaagctggctattgtgcctttgcaggacgtgctggggctgggcccc
gaggcccgcatgaacttccccggacggctgggggacaactgggcgtggcgctacgccgaa
ggcgacctcgagcccggtctggccgcgggactgcgggccctggccgaggccagccagcgc
gcttga

DBGET integrated database retrieval system