KEGG   Meiothermus ruber DSM 1279: Mrub_1170Help
Entry
Mrub_1170         CDS       T01193                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mrub_1170
Enzymes [BR:mrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mrub_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1183470..1184387)
Genome map
AA seq 305 aa AA seqDB search
MRFFVVGDVSVDLIYFLERIPEPGEEVPAQRALMKPGGAGGTLAAHLASLGNKVYLASRV
GDDPFRSVALSQLEKVKVDLKYLQTDPEQTTSSILILLIPGGERSMVSAGGASRYLDAAE
FKPRMLDSIDAVVFSAYAFVGGPQRQYAINVLDAARKREIPIFADLGTGAVRAAGKELLD
ILRGVPYLLMNQVELLALTGATSISYGVNVLKTWGLETVVVKVGAMGSIVITPTRQELIE
PYPLEEVVDTTGSGDAFTATFAHAIMQGKDPFTAARLGNLAGSLAATAIGGQGRLITEED
LLQAR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcggttttttgtcgtaggtgacgtatcagttgacctaatctactttcttgagcgaatc
cccgagccgggagaggaagtaccggcacagcgggccttgatgaaacctgggggggccggg
ggcaccctggcagcccacctggccagcctgggcaacaaagtttatctggccagccgggtg
ggcgatgacccttttcgcagcgtggccctatcgcagcttgaaaaagtcaaggttgatctc
aaatacctgcaaaccgaccccgagcagaccacctcttcaattctgattctgctaattccc
ggcggcgaacgctccatggtctcggcagggggcgccagccgctacctggatgccgccgag
tttaaaccccgaatgctcgactcgatcgacgcggtggttttctcagcttacgcctttgta
ggcgggccgcagcgccagtacgcaattaacgtgctggatgctgcacgcaagcgtgagata
cccatctttgccgacctgggcaccggtgcggtgcgggctgctggtaaagagctgctggat
attttgcgcggggttccctatctgctgatgaaccaggtagagctgctagccctgacaggg
gctacatccatcagttacggggtgaacgtgctcaaaacctggggcctcgagacggtggtg
gtcaaggtgggggccatgggctctattgtgattacccccacccgtcaagagctgattgaa
ccctatcccctcgaggaggtggtggataccaccggctcgggggatgcttttaccgccacc
ttcgcccacgccatcatgcaaggcaaagacccgtttaccgccgcccgcctaggcaacctg
gccggttccctggccgccaccgccattggcgggcagggtcgcctcattaccgaggaggat
cttttacaggcccggtag

DBGET integrated database retrieval system