KEGG   Meiothermus ruber DSM 1279: Mrub_1300Help
Entry
Mrub_1300         CDS       T01193                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00010  Glycolysis / Gluconeogenesis
mrb00620  Pyruvate metabolism
mrb00640  Propanoate metabolism
mrb00680  Methane metabolism
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01120  Microbial metabolism in diverse environments
mrb01130  Biosynthesis of antibiotics
mrb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrub_1300
   00620 Pyruvate metabolism
    Mrub_1300
   00640 Propanoate metabolism
    Mrub_1300
  Energy metabolism
   00680 Methane metabolism
    Mrub_1300
Enzymes [BR:mrb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mrub_1300
Lipid biosynthesis proteins [BR:mrb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mrub_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N PapJ
Motif
Other DBs
NCBI-ProteinID: ADD28062
Position
complement(1328968..1330851)
Genome map
AA seq 627 aa AA seqDB search
MELEQLLKPKVSYQAPEAQRNQANLSDFWAEYTRSLQDPEAFWGEQARRFHWFRPFGQVL
EWNFPDHRWFVGGQTNITYNALDRHAQGAKRNQVALLYLSEDGSEQKLTYGELLDRVSRF
ASGLRALGVEKGDRVIIYMPLTLEGVIAMLACARIGAIHSVVYAGLGVSALRERIMDAGA
RLVIAGDVSYRRGKPVDLESIVLQAIEDLDLHTIWFCRNKAVPEGPRFHDFNNLLWSHKP
EAEAVPLDSEHPLFILYTSGSTGKPKGVVHVHGGYMVGTAYHLRTFFDVKDSDVYWATSD
IGWIVGHSYIVYAPLLEGVTSVLREGAPDHPNPAAIWQAVERYRVNVMFTAPTAVRMFMK
FGPEWPARHDLSSLRFIGVAGEPLNPEAWQWAVEHLMEGGQRGFVADNWWQTELGGPTLG
TPLTLEGRPGFVGVPLPGVEATVVDAEGHEVAPGTGGLLALKRPFPHMMRTVWGNHARYA
QYWTEIPGHVYAAGDVASKTPEGYFAVLGRADDVLNVAGHRIGTADVESALVSHPAVAEA
AVIGVPDPVKGENIKAFVVLRVGHEKTEALRDEIVQHVRLELGPIATPGELVFLDKLPKT
RSGKILRRLLKAQEMGRDPGDLSTLEE
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgagcaactgctaaaacccaaggtcagctaccaggcccccgaggcccagcga
aaccaggccaacctgtccgacttctgggccgagtacacccgcagcctgcaagaccctgag
gcgttctggggtgaacaggcccggcggtttcactggttccggccctttgggcaggtgcta
gagtggaacttccccgaccaccgctggtttgtgggcggccagaccaacatcacctacaac
gccctggatcgccatgcccagggcgccaagcgcaaccaggtcgcgctcctgtacttaagc
gaggacggcagcgagcaaaagctgacctatggcgagctgttggatcgggtctcacgcttt
gcaagcgggctcagagcgttgggggtggaaaaaggcgatcgggtcatcatctacatgccc
ctcaccctggaaggcgttattgccatgctggcctgtgcccgcattggcgccattcactcg
gtggtctatgccgggctgggggtttcagccttgcgcgagcgcatcatggacgccggggcc
aggctggtaatcgccggggacgtgagctaccgccggggcaagccggtagacctcgagtcc
atcgtgctccaggccatcgaagacctagaccttcacaccatctggttctgccgcaacaaa
gccgtgcccgaggggcctcgctttcacgacttcaacaacctgctctggtcgcacaaaccc
gaggccgaagcggttccgctggatagcgagcaccctctgtttatcctctatacctcgggc
tccaccggcaaacccaagggcgtggtgcacgtgcacgggggctacatggtgggcaccgcc
taccacctgcgcacctttttcgatgtgaaggatagcgatgtctactgggccacctcggac
atcggctggattgtggggcacagctacatcgtgtacgcgcctttgctcgagggcgtcacc
agcgtgctgcgggaaggcgcgcccgaccaccccaaccccgccgccatctggcaggccgtc
gagcgctaccgggtcaacgtgatgttcaccgctcccacggcggttcgcatgttcatgaag
tttggccccgaatggcccgcccggcacgacctctcctcgctgcggttcatcggggtggcc
ggcgagcccctcaaccccgaggcctggcaatgggcggttgagcacctgatggagggcggc
cagcgcggctttgtggccgataactggtggcagaccgaactgggcggccccaccctgggc
accccgctcaccctggagggccggcccggctttgtaggggtgcccctgcccggcgtggag
gccacggtggtggatgccgagggccacgaggtagcccccggaaccggcggcttgctcgcg
ctcaagcgccccttcccccacatgatgcgcacggtctggggcaaccacgcccgctacgcc
cagtactggacggaaatccccggccacgtgtatgccgccggcgacgtggccagcaaaacc
ccagagggctactttgcggtgctgggtcgggccgacgatgtgctaaacgtggccgggcac
cgcatcggcaccgccgacgtagagagcgccctggtctcacacccagcggtggctgaggcc
gcggtaattggggtacccgaccctgtcaaaggtgaaaacatcaaggcttttgtggtttta
cgggtaggacacgaaaaaaccgaggccctgcgagacgaaatcgtgcagcatgtgcggctc
gagctgggccccatcgccacccccggtgaactggttttcctggacaagctccccaagacc
cgcagcgggaaaattctgcgccgcctgctcaaggcccaggagatggggcgggatcccggc
gatttgagcacgctcgaggagtag

DBGET integrated database retrieval system