KEGG   Meiothermus ruber DSM 1279: Mrub_1399Help
Entry
Mrub_1399         CDS       T01193                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mrub_1399
Enzymes [BR:mrb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mrub_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1435356..1436036
Genome map
AA seq 226 aa AA seqDB search
MRIALTQSEGRLEGLQERLEAMGLEVLRFPLVQTQTLPADLAPLDDCRWWLFTSVAAVRA
VLELRGSLPGRALGAVGRATQQALEEAGGRVDLVAPEETAESLAEAFLALRPFGFVGLPQ
GNRARPVLAQRLREAGYVVRSVVVYQTQTLPWPSDGPVPELVLLTSPTGVEALPEAVGRK
VHLLALGPTTAAALSERGFPHTVVPRPSVEAVLETVRYIRGELCSI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgccctaacccagtctgaaggccgtttggaaggtttgcaggagcgcctggag
gcgatgggcctcgaggtgctgcgctttccgctggttcagacccagaccctgcccgccgat
ttagcgccgctggatgactgccgctggtggctgtttaccagcgtggcggcggtgcgggcg
gtgctcgagctgaggggtagcctgccaggtcgggcgctgggggcggtgggccgggccacc
caacaggccctggaagaggccggcggcagggtagacctggtcgcccccgaggagaccgcc
gagagcctggccgaggcgtttctggccctcaggccttttggatttgtggggctgccgcag
ggcaaccgcgcgcgcccggtgctggcccagcgcctgcgggaagcaggctacgtggtgcgc
agtgtggtggtttatcagacccagaccctgccctggccgtccgatggccctgttcccgag
ctggtgctgctgaccagccccaccggggtggaagccttaccggaggcggttgggcgcaag
gtccatctgctggcgttgggccccaccacggcggcggccctgtccgagcggggttttccg
cacacagtggtgccgaggcccagcgtggaagccgttctggagacagtccggtacatccga
ggtgaattatgctcgatttag

DBGET integrated database retrieval system