KEGG   Meiothermus ruber DSM 1279: Mrub_1400Help
Entry
Mrub_1400         CDS       T01193                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mrub_1400
Enzymes [BR:mrb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mrub_1400
Exosome [BR:mrb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mrub_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1436024..1437061
Genome map
AA seq 345 aa AA seqDB search
MLDLDNPEVQSLEAPPDLVRRPRRLRTSAALRESVAETHLRPTDFLAPFFITTGRDLAEP
IATLPGIHRYSVDRFLLEVERALELGLRSLLLFGVLPDTWKDPFGQSAADPNGPVPTAIR
EARKAFGEDVVIYTDVCLCAHTTHGHCGVLKETPRGVQIDNDRSLPQLAAMALAHAEAGA
DFVAPSDMMDGRVGYLRRALDQAGHTGVGILSYAVKYASAFYGPFRDAAKSAPSFGDRAS
YQMDIRNAREALREAALDEAEGADMLMVKPALAYLDILARLRPQTQLPLVAYNVSGEYAM
LKAAAQAGVLDEARAVRETLVAIKRAGADLIISYHAQEALAQGWI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatttagacaaccccgaagtgcagtccctcgaggccccgcccgaccttgtgcgg
cgcccgcgccgtttgcgcaccagcgcggccctgcgcgagagcgtggccgagacccacctg
cgccccaccgacttcctggcgccgttcttcattacgacgggtcgggatctggctgaaccc
atcgccacgctgcccggcattcaccgctacagcgtggataggttcttgctcgaggtcgag
cgcgccctcgagctgggcctgcgcagcctgctgctttttggtgtgctgcccgatacctgg
aaagaccccttcggtcagagcgccgccgatcccaacggcccggtgcccaccgccatccgg
gaagcccgcaaggcctttggcgaggatgtggtcatctacaccgacgtctgcctgtgcgcc
cacaccacccacggccactgcggggtgctgaaagagacccctcgaggggtgcagatcgac
aacgaccgctcgctgccgcaactggccgccatggccctggcccacgccgaggccggcgcc
gattttgtagccccctccgacatgatggacgggcgggtgggctacctgcgccgtgccctg
gatcaggccggccatactggggtgggcatcctctcgtacgccgtcaagtacgccagcgct
ttttacggcccattccgcgatgcggccaagagcgcccccagttttggcgaccgggccagc
taccagatggacatccgcaacgcccgcgaggccctacgcgaagccgccctcgacgaggcc
gaaggggcggatatgctcatggtgaagcccgcgctggcctacctcgatattctggcccgc
ctgcgcccgcagacccaactgcctttggtggcctacaacgtgagcggcgagtacgccatg
ctcaaggcggcggcccaggctggggtgctggacgaggcccgggcggtgcgcgagaccctg
gtggccatcaagcgggccggggccgacctgatcatcagctaccacgcccaggaggccctg
gcccagggctggatctga

DBGET integrated database retrieval system