KEGG   Meiothermus ruber DSM 1279: Mrub_1512Help
Entry
Mrub_1512         CDS       T01193                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mrub_1512
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrub_1512
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mrub_1512
Enzymes [BR:mrb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mrub_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1544300..1545091
Genome map
AA seq 263 aa AA seqDB search
MTTREAFARARAEGRAALIPYVMAGYPSRGRDLEIVEQVLPYADLLEVGLPYSDPLGDGP
VIQRASEQALRQGLRVAEVAGFVQEIRALTDKPLFLMTYINPVLAVGPAAFFQMFKEAGA
TGLILPDLPPDEDPELVSLAQRAGLETTFLLAPTSTDARIQAVTPHCTGFVYTVSVAGVT
GARDRLPEGLPELVQRIRRFTDAPVAIGFGISNRATAQQAAQAADGAVIASALIRALEEG
RGLAEVLSEVQAGLQGAVGQFMG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcgaagcctttgccagggccagagccgagggccgggcggccctgattcct
tacgtgatggccggctaccccagccgtgggcgcgacctggaaattgtggagcaggtgctg
ccctatgccgacctgctcgaggtgggcctgccctactccgaccccttgggcgacgggccg
gtgatccagcgggcctccgagcaagccctgcggcagggcctgcgggtggccgaggtggcc
gggttcgtgcaggaaatccgggccctgaccgacaagcccctctttctgatgacctacatt
aacccggtgctggcggtgggcccggcggccttcttccagatgttcaaggaggccggggcc
acgggcctgattctgcccgacctgccccccgacgaagacccagagctggtgtcgctggcc
cagcgggcgggcctcgagaccaccttcctgctggcccccacctccaccgacgcccgcatc
caggccgtcacccctcactgcaccggcttcgtctacaccgtctcggtggccggggtgacc
ggcgcgcgggatcggctgccggagggcctgcccgagctggtgcagcgcattaggcgcttc
accgatgcgccggtggcgattggctttggcatctccaaccgggccaccgcccagcaagcg
gcccaggccgccgacggggcggtgatcgccagcgccctgatccgggcgctggaggagggg
cgggggctcgcggaggtcttgagcgaggtgcaagcgggcctgcagggtgcggtcggccag
ttcatgggctag

DBGET integrated database retrieval system