KEGG   Meiothermus ruber DSM 1279: Mrub_1520Help
Entry
Mrub_1520         CDS       T01193                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_1520
   01230 Biosynthesis of amino acids
    Mrub_1520
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrub_1520
   00051 Fructose and mannose metabolism
    Mrub_1520
   00562 Inositol phosphate metabolism
    Mrub_1520
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mrub_1520
Enzymes [BR:mrb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mrub_1520
Exosome [BR:mrb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mrub_1520
  Exosomal proteins of bladder cancer cells
   Mrub_1520
  Exosomal proteins of melanoma cells
   Mrub_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1552612..1553358)
Genome map
AA seq 248 aa AA seqDB search
MRKRLVAGNWKMHKTPSEARMWFRDLTAHLPQTQAEPALLVPFTHLPYAAEVLEGHGVHW
GAQDVSAHTEGAYTGEVSAKMLADLACQYTIVGHSERRSYHAESDALVAEKARRLLEQGI
TPILCVGEPLEVREAGSHVEYTLQQLEGSLQGVNPASPQHLVIAYEPVWAIGTGKTATPE
DAEAMHQAIRGWLEGRYGADFAGQMRILYGGSVKPENATALFAQPNIDGGLVGGASLKLE
DYIKLLTA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagcgactcgtagccggtaactggaaaatgcacaaaaccccctccgaagcccgg
atgtggtttcgcgacctgaccgcccacctaccccagacccaggccgaaccggccctgctg
gtaccttttacccatctgccctatgctgcggaagtcctcgagggccatggggtgcactgg
ggcgcgcaggatgtctcggcccataccgaaggggcctacaccggcgaggtttcagcaaaa
atgctggccgatctggcttgccaatacaccatcgtgggccactccgagcggcgcagctac
cacgccgagtcggatgcgctggtagcggaaaaagcccggcgtctattggagcagggcatc
acccccatcctgtgcgtgggcgagcccctggaagtgcgcgaggccggaagccatgtcgag
tacaccctgcagcagctcgaggggagcctgcaaggggtcaacccggcctcaccccagcat
ctggtgattgcctacgagccggtctgggccattggcaccggcaaaaccgccacccccgag
gatgccgaggccatgcaccaggccattcgtggctggctggaaggccgctacggtgcggac
tttgccgggcagatgcgcatcctttacggcggctcggtcaagcccgagaacgccacggcc
ctctttgcccagcccaacattgatgggggactggtcgggggggccagccttaagctggag
gactacataaagctgctcacggcctaa

DBGET integrated database retrieval system