KEGG   Meiothermus ruber DSM 1279: Mrub_1529Help
Entry
Mrub_1529         CDS       T01193                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mrb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1564373..1564987
Genome map
AA seq 204 aa AA seqDB search
MRARLYLTFQQIGADLFAAGLASATSGNYSARERDGFWITRSGVQKAHLTPEDLIFLPLE
PDPLRDQGASVERVIHRAIYRQTDATAVVHAHPRHAIALSFHLQVIEPIDLEGRYYFEHI
PVVAPATLSGTQEAAEAVAQALQENPACVVRGHGAFVKSSLEVPEQALLQAYSLMTSLEE
ACEVLFLERLWRGFSGDGLGEASE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagagccagactctatctaaccttccagcaaataggtgccgatttattcgcggcgggg
ctggcctcggccacctcggggaactactcagcgcgtgagcgcgatgggttctggattacc
cgatcgggcgtccagaaagcccacctgaccccggaagacttaatcttcttacccttggaa
cccgaccccctgcgggaccagggggcctcggtggagcgggtgattcaccgcgccatctat
aggcaaaccgatgccaccgcggtggtgcatgcgcacccccgccacgccatagcgctttcg
ttccaccttcaggtcattgagccgattgacctcgagggccgctactacttcgaacacatc
ccggtggtagcccccgcaaccctttcgggcacccaggaggccgccgaggcggtagcccag
gcgctgcaagaaaaccccgcctgcgtagtccggggccatggggcttttgtaaagagcagc
ctggaagtgccagaacaggcccttctgcaggcctactcgctgatgacgagcctcgaggaa
gcctgcgaagtgctgttcttagagcgcttgtggcggggcttttccggggatggtttaggc
gaggcttcggagtag

DBGET integrated database retrieval system