KEGG   Meiothermus ruber DSM 1279: Mrub_1529Help
Entry
Mrub_1529         CDS       T01193                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mrub_1529
Enzymes [BR:mrb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mrub_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1564373..1564987
Genome map
AA seq 204 aa AA seqDB search
MRARLYLTFQQIGADLFAAGLASATSGNYSARERDGFWITRSGVQKAHLTPEDLIFLPLE
PDPLRDQGASVERVIHRAIYRQTDATAVVHAHPRHAIALSFHLQVIEPIDLEGRYYFEHI
PVVAPATLSGTQEAAEAVAQALQENPACVVRGHGAFVKSSLEVPEQALLQAYSLMTSLEE
ACEVLFLERLWRGFSGDGLGEASE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagagccagactctatctaaccttccagcaaataggtgccgatttattcgcggcgggg
ctggcctcggccacctcggggaactactcagcgcgtgagcgcgatgggttctggattacc
cgatcgggcgtccagaaagcccacctgaccccggaagacttaatcttcttacccttggaa
cccgaccccctgcgggaccagggggcctcggtggagcgggtgattcaccgcgccatctat
aggcaaaccgatgccaccgcggtggtgcatgcgcacccccgccacgccatagcgctttcg
ttccaccttcaggtcattgagccgattgacctcgagggccgctactacttcgaacacatc
ccggtggtagcccccgcaaccctttcgggcacccaggaggccgccgaggcggtagcccag
gcgctgcaagaaaaccccgcctgcgtagtccggggccatggggcttttgtaaagagcagc
ctggaagtgccagaacaggcccttctgcaggcctactcgctgatgacgagcctcgaggaa
gcctgcgaagtgctgttcttagagcgcttgtggcggggcttttccggggatggtttaggc
gaggcttcggagtag

DBGET integrated database retrieval system