KEGG   Meiothermus ruber DSM 1279: Mrub_1533Help
Entry
Mrub_1533         CDS       T01193                                 

Definition
2-oxoglutarate dehydrogenase E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mrb01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mrb00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mrb00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1567686..1568873)
Genome map
AA seq 395 aa AA seqDB search
MALELKIPAVGESITEVEIGQWLKKEGDTVKVDEPLVELVTDKATLELPAPVAGRLTKIL
IPSGQAKVGDVVALLEEGAAEASSGAPSQSTPAPSQAAATESKVMPAAERLAAQAGLQAS
SIPGSGPGGRVLKEDVQRAVTTPPPTPQPTPSAPPAPPVQKGERREDVVPMTPLRRRIAE
RLLAAKQNTAMLTTFNEADMSAVMELRKEYGEAFQKKYGFKLGFMSFFVKAVVQALQEIP
QLNAEIRGTDIVYHRYYDIGIAVGGGEGLVVPVIRDADRLSMAQIEAVIADFGARVREKK
IKPEELMGGTFTITNGGIYGSLNSTPILNPPQVGILGMHAIVERPVAKNGAVVIRPMMNL
ALSYDHRIVDGREAVTFLKRIKELIENPVRLTLEI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccttagaactgaaaatacctgcagttggcgagtccatcaccgaagttgagattggt
cagtggcttaagaaggaaggggacacggttaaggttgatgagcccctggtggaactggtt
accgataaagccaccctcgagctgcccgcaccggtggccgggcggctgaccaaaatcctc
atccccagtggacaggccaaggtgggcgatgtggtagccctgctggaagaaggcgccgcc
gaagcctcgagcggcgcccccagccagagcaccccggcccccagccaggccgcggccacc
gagagcaaggtgatgccggcagccgagcgactggcggcacaggccggcctgcaggcctcg
agcattccgggtagcggcccgggcggccgggtcttgaaagaagacgtacagcgagcggta
accacaccgccccccaccccgcaacccacgcccagcgccccgcccgccccgccagtacaa
aaaggcgaacgccgcgaggatgtggtgcccatgacccccctgcgccgccgcattgccgag
cgtttgctggcagccaagcagaataccgccatgctcaccaccttcaacgaggccgatatg
agcgcggtgatggagctgcgcaaggagtacggcgaggccttccagaagaaatacggcttc
aagctgggctttatgagcttttttgtgaaagcggtggtgcaggccctgcaggaaatcccg
cagctcaacgccgagatccgcggaaccgatatcgtttaccaccgctactacgacatcggc
atcgccgtgggcgggggcgagggcctggtggtaccggtgattcgcgatgccgaccggctc
tcgatggcccagattgaggcggtaattgccgactttggagccagggtacgggaaaagaaa
atcaaacccgaagagttgatgggcggtaccttcaccatcaccaacgggggcatctacggc
tcgctcaactccacgcccattctcaatccgccccaggtgggcatcctgggcatgcacgcc
atcgtcgagcgtccggttgccaaaaacggcgcagtggtcatccgcccgatgatgaacctg
gccctttcctacgatcaccgcattgtggatgggcgggaggccgtcaccttcctcaagcgc
atcaaggaactcatcgaaaaccccgtacggctaaccctggaaatctaa

DBGET integrated database retrieval system