KEGG   Meiothermus ruber DSM 1279: Mrub_1533Help
Entry
Mrub_1533         CDS       T01193                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrub_1533
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mrub_1533
  Amino acid metabolism
   00310 Lysine degradation
    Mrub_1533
Enzymes [BR:mrb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mrub_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1567686..1568873)
Genome map
AA seq 395 aa AA seqDB search
MALELKIPAVGESITEVEIGQWLKKEGDTVKVDEPLVELVTDKATLELPAPVAGRLTKIL
IPSGQAKVGDVVALLEEGAAEASSGAPSQSTPAPSQAAATESKVMPAAERLAAQAGLQAS
SIPGSGPGGRVLKEDVQRAVTTPPPTPQPTPSAPPAPPVQKGERREDVVPMTPLRRRIAE
RLLAAKQNTAMLTTFNEADMSAVMELRKEYGEAFQKKYGFKLGFMSFFVKAVVQALQEIP
QLNAEIRGTDIVYHRYYDIGIAVGGGEGLVVPVIRDADRLSMAQIEAVIADFGARVREKK
IKPEELMGGTFTITNGGIYGSLNSTPILNPPQVGILGMHAIVERPVAKNGAVVIRPMMNL
ALSYDHRIVDGREAVTFLKRIKELIENPVRLTLEI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccttagaactgaaaatacctgcagttggcgagtccatcaccgaagttgagattggt
cagtggcttaagaaggaaggggacacggttaaggttgatgagcccctggtggaactggtt
accgataaagccaccctcgagctgcccgcaccggtggccgggcggctgaccaaaatcctc
atccccagtggacaggccaaggtgggcgatgtggtagccctgctggaagaaggcgccgcc
gaagcctcgagcggcgcccccagccagagcaccccggcccccagccaggccgcggccacc
gagagcaaggtgatgccggcagccgagcgactggcggcacaggccggcctgcaggcctcg
agcattccgggtagcggcccgggcggccgggtcttgaaagaagacgtacagcgagcggta
accacaccgccccccaccccgcaacccacgcccagcgccccgcccgccccgccagtacaa
aaaggcgaacgccgcgaggatgtggtgcccatgacccccctgcgccgccgcattgccgag
cgtttgctggcagccaagcagaataccgccatgctcaccaccttcaacgaggccgatatg
agcgcggtgatggagctgcgcaaggagtacggcgaggccttccagaagaaatacggcttc
aagctgggctttatgagcttttttgtgaaagcggtggtgcaggccctgcaggaaatcccg
cagctcaacgccgagatccgcggaaccgatatcgtttaccaccgctactacgacatcggc
atcgccgtgggcgggggcgagggcctggtggtaccggtgattcgcgatgccgaccggctc
tcgatggcccagattgaggcggtaattgccgactttggagccagggtacgggaaaagaaa
atcaaacccgaagagttgatgggcggtaccttcaccatcaccaacgggggcatctacggc
tcgctcaactccacgcccattctcaatccgccccaggtgggcatcctgggcatgcacgcc
atcgtcgagcgtccggttgccaaaaacggcgcagtggtcatccgcccgatgatgaacctg
gccctttcctacgatcaccgcattgtggatgggcgggaggccgtcaccttcctcaagcgc
atcaaggaactcatcgaaaaccccgtacggctaaccctggaaatctaa

DBGET integrated database retrieval system