KEGG   Meiothermus ruber DSM 1279: Mrub_1680Help
Entry
Mrub_1680         CDS       T01193                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mrub_1680
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mrub_1680
Enzymes [BR:mrb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mrub_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1715511..1716269
Genome map
AA seq 252 aa AA seqDB search
MQLKGKTALITGAGSGIGRAIAEVFAREGARVILNDLSPAAGEVAKAVGGTFIQADLSDQ
QAVRDLAQRALELGPIDILVNNAGLQRIHPVDEFPLETWNLMLQVLLTAPFQLIKHTLPA
MKQRRWGRIINIASLHGLVASPYKSAYIAAKHGLLGLTKTVALEVGEYGITCNAICPAYV
RTPLVTSQIADQARTLGIPEAQVIEQVMLAPAAIRRLIEPEEVAEYALFLASDKAGAITG
SAQVMDLGWTAR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaagggaaaaaccgccctcatcaccggtgcaggtagcggcattggcagggcc
atcgccgaagtgttcgcccgggaaggggccagggtaatcctcaacgatctgtcccccgca
gccggcgaagtcgccaaggccgtggggggcacctttattcaggccgacctctccgatcag
caggccgttagagacctggcccaacgggcgctcgagctgggccccatcgacatcctggtg
aataacgccggcttgcagcgcatccatccggtggatgagtttcccctggaaacctggaac
ctcatgctccaggtgctgctcacggccccatttcagctcatcaagcacaccctaccggcc
atgaagcaaaggcgttggggccggattatcaacatcgcgtcgttacacggcttggtcgcc
agcccctacaagtcggcctacatcgcggccaagcacggcttactgggcctgaccaaaacg
gtggcgctcgaggtcggggagtacggcatcacctgcaacgccatctgcccggcctacgtg
cgcacccccctggtcacctcgcaaattgccgaccaggcccgcacgctgggcatccctgaa
gcccaggtcatcgaacaggtcatgctggcgcccgcggctatcaggcgcctcatcgagccc
gaagaggtagcagagtacgcactgttcctggcttccgataaggccggggccatcacaggt
tcggcgcaggtgatggatctgggctggacggcgcgctag

DBGET integrated database retrieval system