KEGG   Meiothermus ruber DSM 1279: Mrub_1785Help
Entry
Mrub_1785         CDS       T01193                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mrub_1785
Enzymes [BR:mrb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Mrub_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1837588..1838715
Genome map
AA seq 375 aa AA seqDB search
MNDNPKRVVVLGSTGSIGTQTLDVCRWRGYRVVGLVAGKNLELLTQQIAEFRPEVVAADP
SILPELESRFPGLRTADALEVAAWPAEVVVGAIPGLAGLPGVRAAVQQGRRLALANKESM
VAAGPLLWQEAEQSGAEIIPVDSEHSALFQSLLGEPLDDVAELILTASGGPFLREPADLS
SVTPQMALQHPRWKMGPKVTIDSSTLFNKGLEVLEAVQLFKVPIEKVKVQIHPQSYVHSM
VRFQDGNLKAQLGPTDMRLAIQYALTHPQRPPSPLREAPIPERLEFYPPDTRRFPALALA
YEAGRMGGLAPVVLNAADEIAVEAFLQGQIGYLEIPRVLEKVLQQTPAGALTWDNIAYAD
LEARRWAREYLKVKV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataatcccaaacgcgttgtggtgctgggctcaaccggttctattggcacccag
accctggatgtctgccgctggcggggctaccgggtggtggggttggtggccggtaagaac
ctggagcttttgacccagcagattgctgagtttcgacccgaggtagtggccgccgaccct
tccatcctccccgaactcgagtcccgctttcccggtttgcgcaccgccgacgccctcgag
gtggccgcctggccggccgaggtggtggtgggagccataccgggcctggcgggcctgccg
ggggtgcgggcagccgtacagcaaggccgccgcctggccctcgccaacaaagagagcatg
gtggccgccgggccgctgctgtggcaggaggccgagcagagcggggccgaaattatcccg
gtggactcagagcactcggccctgttccagagtcttttgggcgagccgttggacgacgta
gccgagctgattctcacagcttctggcgggccttttttgcgggaaccggccgacctttcc
agcgttaccccccagatggccctccagcacccccgctggaagatggggcccaaggtgacc
attgactcttcgacgcttttcaacaagggcctcgaggtgctggaagccgtgcagttgttc
aaagtgcccatcgagaaggtcaaggtgcagattcacccccaatcgtatgtgcactccatg
gtgcgcttccaggacggcaacctcaaggcccagctcggccccaccgatatgcggctggct
atccagtacgccctcacccacccccagaggcccccttccccgctgcgcgaggcccccatc
cccgagcggctggagttttacccaccggataccaggcgcttcccagccctggccctggcc
tatgaggccggacggatgggggggctggccccggtggtgctcaacgctgccgacgaaatc
gcggtggaggcctttttacaagggcagattggttacctggaaatcccaagggtgctggaa
aaagtgttacagcagactcctgcaggcgcactaacctgggacaatatcgcttatgccgac
ctcgaggcccgccggtgggcccgtgagtacctgaaggtaaaggtctga

DBGET integrated database retrieval system